KEGG   Aspergillus nidulans: AN6138.2Help
Entry
AN6138.2          CDS       T01016                                 

Definition
(RefSeq) BIMA_EMENI Protein bimA
  KO
K03350  anaphase-promoting complex subunit 3
Organism
ani  Aspergillus nidulans
Pathway
ani04111  Cell cycle - yeast
ani04113  Meiosis - yeast
ani04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ani00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    AN6138.2
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    AN6138.2
   04113 Meiosis - yeast
    AN6138.2
Protein phosphatases and associated proteins [BR:ani01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     AN6138.2
Ubiquitin system [BR:ani04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     AN6138.2
Chromosome and associated proteins [BR:ani03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    AN6138.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_1 TPR_2 TPR_8 ANAPC3 TPR_19 TPR_14 TPR_12 TPR_11 TPR_16 TPR_7 TPR_17 TPR_9 TPR_15 DUF410 DUF5470
Motif
Other DBs
NCBI-GeneID: 2871215
NCBI-ProteinID: XP_663742
UniProt: P17885
Position
I
AA seq 788 aa AA seqDB search
MTPSTSHISSQLRQLIYYHLDNNLARNALFLAGRLHAYEPRTSEASYLLALCYLQNGQVK
AAWETSKHFGSRGAHLGCSYVYAQACLDLGKYTDGINALERSKGQWTSRNHWNKHSETRR
QHLPDAAAVLCLQGKLWQAHKEHNKAVECYAAALKLNPFMWDAFLNLCETGVDLRVSNIY
KMSPELYSMVSSAALEDVESQVLPPDGPLQTQVNPNPSLDPFTAGTTRSDSTSTHGSSAL
WEKLNGSTVSVASSGTGPHLPREGMETPGGQSSESDDPRVTNGNGTDVFEPPLAPAKKNR
TIQTIGGDHPMDPPPKMRPTGIRPRTRTKFESDEGHTERDAGMGHRLGDRKRTVSGQVAH
PSVPHSTDQGVGQRRSVRLFNQIKPSTNKISSTALGVKEGREVKKVRTTGNKARTTTSSN
VGRVVSGNNRRHAGEIHDGDSKEYRGTSSTSNGSQNASSKLAISERTKSVEALAWILDLF
FKIASGYFCLSRYKCSDAIQIFSSLSQGQRETPWVLAQIGRAYYEQAMYTEAEKYFVRVK
AMAPSRLEDMEIYSTVLWHLKNDVELAYLAHELMDVDRLSPEAWCAVGNSFSHQRDHDQA
LKCFKRATQLDPHFAYGFTLQGHEYADSRHYNAWYGLGTVYDKMGKLDFAEQHFRNAAKI
NPSNAVLICCIGLVLEKMNNPKSALIQYNRACTLAPHSVLARFRKARALMKLQDLKSALT
ELKVLKDMAPDEANVHYLLGKLYKMLRDKGNAIKHFTTALNLDPKAAQYIKDAMEALDDD
EEDEEDMA
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgactccgtccacatcacatatttcgagccagctaaggcagctgatatattaccatctt
gacaacaaccttgctcggaacgcgctgttccttgccggtcgtttacacgcctacgaacct
cggacgtcggaagcttcgtacctattagctctgtgttacctacaaaatggtcaggtgaaa
gcagcatgggaaactagcaagcattttgggtcgaggggtgcgcatcttggatgttcttac
gtctacgcgcaggcttgtcttgacctcgggaaatatacggacggtattaacgcgctagag
cgaagtaagggacaatggacttcgcgaaaccactggaataaacacagtgagacgcgacga
caacacttgccggatgctgcggcagttttatgtttgcaaggaaaattatggcaggcacac
aaggaacacaacaaggctgtggagtgttacgctgcagctttaaagctgaatcccttcatg
tgggatgcattcttgaatctgtgcgaaactggtgttgatttgcgtgtttcaaacatatat
aagatgagcccggaattgtacagcatggtatcgtctgctgcgctcgaagatgttgaatcc
caggttctacctccggacggtccactccagacacaagttaacccaaatccgagcttggac
ccgttcactgccggtacgactcgcagcgattcgacctctactcacgggagctcagctttg
tgggaaaagttgaatggaagcacagttagtgtggcatcttcaggaacaggaccgcatctt
ccgcgggaaggcatggagactcctggtggccaaagtagcgaatctgatgatccacgtgta
accaacggtaatggcacagatgtttttgagccgccgctagcccctgcaaagaagaatcga
acgatccaaacaataggcggcgatcatccgatggatcccccgccaaagatgcggccaacc
ggtattcgaccgaggacccgaaccaaattcgagtcagatgaaggtcatactgagagagac
gcgggcatgggtcacaggttaggcgatcggaaacgaacggtctctggacaagttgcgcat
ccgtcggtaccgcattcaaccgaccaaggtgtcgggcaacggcgaagtgtacgtctcttt
aaccagataaagccatcaacgaacaaaatatctagcacggcattaggagtgaaagagggc
cgggaggtgaaaaaggtgagaactacggggaataaggcgcgcacaacaacaagctcaaat
gtgggccgtgttgttagcggcaacaatcgacgacacgctggggagatccatgacggagac
agcaaagaataccgtggaacatcttcaacatcaaatggctctcagaacgcatcgtctaag
ctcgctatatctgagcggaccaaatcggttgaagccttggcttggattttggacttgttt
ttcaagatagcctccggctatttctgtctcagccggtacaaatgctccgatgctatccag
attttcagctctctatcccagggccaacgggagacaccgtgggttcttgctcaaattgga
cgagcttactacgagcaagcaatgtatacagaggccgagaaatactttgtccgggtgaag
gccatggcgccttcccggttagaagatatggagatctactcgacggttctttggcatttg
aagaatgatgtcgaacttgcttacctggcccatgagttaatggatgtcgatcgcttatca
ccagaagcttggtgtgctgtcggtaactcgttctcacaccagcgggaccacgatcaagct
ctgaagtgcttcaagcgtgccactcaattggatcctcatttcgcgtatgggttcacgcta
cagggccatgagtatgcggacagtcgacattataatgcctggtacgggctgggaacggtc
tacgataagatgggcaaacttgactttgctgaacagcacttccgtaatgcggccaagatt
aatccttctaatgctgttttaatatgctgcattggcttggtcttagagaagatgaacaat
ccgaagtcagcgttgatccagtacaacagggcctgcaccctcgcgcctcattctgttctt
gctcgattccgaaaagcccgtgcgttgatgaaattgcaggatctcaagtcagcgcttacg
gagctgaaggttctgaaggacatggcgccggatgaggcaaacgttcattacctcctgggc
aaactgtataagatgcttcgtgacaagggaaatgccattaagcacttcacaactgcatta
aaccttgatcccaaggcggcgcagtacatcaaagatgcaatggaagcccttgacgacgat
gaagaggatgaagaagatatggcgtga

DBGET integrated database retrieval system