KEGG   Aspergillus nidulans: AN6299.2
Entry
AN6299.2          CDS       T01016                                 
Name
(RefSeq) hypothetical protein
  KO
K22733  magnesium transporter
Organism
ani  Aspergillus nidulans
Brite
KEGG Orthology (KO) [BR:ani00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ani02000]
    AN6299.2
Transporters [BR:ani02000]
 Solute carrier family (SLC)
  SLC57: NiPA-like magnesium transporter
   AN6299.2
SSDB
Motif
Pfam: Mg_trans_NIPA EamA
Other DBs
NCBI-GeneID: 2870979
NCBI-ProteinID: XP_663903
UniProt: Q5AZI1 A0A1U8QYW2
Position
I
AA seq 691 aa
MDLSPRSGISSGGDRPPAYKAIGISLAVASGVFIGVSFVLKKVGLLRANVKYNEEAGEGY
GYLKNLWWWSGMTLMIIGEICNFVAYAFVDAILVTPLGALSVVITTILSAIFLKERLSFV
GKVGCFSCILGSVVIALNAPEQSSVADIQDMKKYVIAPGFLSYAGVIIVACAITAIWAGP
RYGKRSMFVYISICSLIGGLSVVATQGLGAALLAQINGEAQFKEWFMYVLLVFVVATLLT
EIIYLNKALNIFNAALVTPTYYVFFTSSTIISSAILFRGFKGTGTQIASVILGFLQICAG
VVLLQLSKSAKDVPDAAVFKGDLDQVREVATQEEPEFEPKADAIRGTAAIIRRLSTPRRN
VEAEEARRYLRERQEDQLRPPADNEIVEWDGLRRRKTVLSEKSQRRTPTPLPPLGMSRFP
DDLSEDSHNTSPSVHTFMNEVRSRTSSIMSSPWRPIPGDQQTHGPVLEPDPKVVDTSYPG
QHPPRAVSWVDEEQDQSHLAAPAPPPHRHFSFQKIFSRAKSPVDPSSADSRSHTRSRSPR
GILRRGHMRNMTSEEEHLGLVQGDKVSGYTNEDEKHERTRTNIQSNHDEDDYETYNYDTY
DYYDDGKLDDLPSGRRLDSHSSLYPPRLRLNPLSPLPDNESALDVSHIRNDQQQYQPQPE
QQQPLESSKGSLLTIPRRQSGWRRQDSASSG
NT seq 2076 nt   +upstreamnt  +downstreamnt
atggatctctcccctcgttctggcatcagttccggcggtgaccgtcccccagcgtacaaa
gcgattggaatatcactagccgtcgcctctggcgtctttattggggtttcattcgtactg
aaaaaagttggtctcctgcgggcgaatgtcaaatacaatgaggaagctggcgaaggatat
ggctacctcaagaatctgtggtggtggtcgggcatgacgctcatgatcattggcgagatc
tgcaattttgtggcatatgcttttgttgacgccatcctggtgacgcctctaggcgctctc
tcggtagtgatcacaacaattttgtccgccatctttctcaaggagcgcctgagtttcgtg
gggaaagtgggctgtttttcctgtatcctgggctcagtagtcattgcgttgaatgcgcct
gagcagtcgtcggttgcggacatccaggatatgaagaagtatgttatagcgccggggttc
ctgtcgtacgccggagtcatcattgtggcgtgcgccataacagctatatgggcagggccg
cggtacggcaagcggagcatgttcgtctacatcagcatctgcagtctcattggaggcttg
agtgtagtagcgactcagggcttgggagctgcacttctagctcaaatcaacggcgaggcc
cagttcaaagagtggtttatgtatgtgttgctcgtatttgtggttgcaacattattgacc
gagatcatatatctcaacaaagccctgaacatctttaacgccgctctggttacgcccact
tactacgtcttcttcaccagctcgaccattatttcctctgcgatccttttccggggcttc
aaagggacaggcacgcaaattgcttctgtcatcttgggattcctacaaatctgcgctgga
gtggtgttgctacaattgtcgaaatccgccaaagatgtccctgacgccgccgtcttcaaa
ggtgacctcgatcaagtccgtgaagttgcaacgcaagaagagcctgaattcgagccaaaa
gccgacgccatccgtggcacagccgctatcattcgccgcctatctactccccgccgcaat
gtcgaggccgaggaagcacgtcgctatctccgtgagagacaagaagaccagctcagacca
cccgctgacaacgagattgtcgaatgggacggcttgcgcaggcgcaagaccgttctttct
gaaaagtcccagaggcgcacacctactcctctacctccgctaggaatgtctcgcttcccg
gatgacttgtccgaagactcccacaatacctcccccagtgtgcatacgtttatgaacgag
gttcgatcgcggacgtctagcatcatgagctccccgtggagacctatccctggagaccaa
caaacgcatgggccggtgttggaaccagatcccaaagttgtcgataccagctaccctggg
caacatcctcctagggctgtctcatgggtggacgaagagcaagaccaatcgcacctagct
gcgccagcacctccgccgcatcgtcatttctcattccagaagatcttcagcagagctaag
tcacctgttgacccatcatcagcagacagccgcagccacacccgcagtcgcagccccaga
ggcattctgcgccgcggacacatgcggaatatgacgtccgaagaggagcacctaggactt
gttcagggagacaaagtttccggatacacgaacgaggatgagaaacacgaacgaacacgc
acgaatatacagagtaaccatgatgaagatgactatgagacctacaattacgatacgtat
gactactatgatgacggaaaattggacgatctgccctctggccggcgcctagactcccat
tcatctctttacccccctcgactccgactaaacccgctatcgccattaccggataacgag
tccgcactagatgtgtctcatattagaaacgaccaacaacagtatcaaccacagccggag
caacagcagcccctagaaagtagtaaaggatcgttgctaaccattccacggaggcagagt
gggtggcgccggcaagattcggcaagcagcgggtag

DBGET integrated database retrieval system