KEGG   Aspergillus nidulans: AN6525.2Help
Entry
AN6525.2          CDS       T01016                                 

Definition
(RefSeq) FDH_EMENI Probable formate dehydrogenase (NAD-dependent formate dehydrogenase) (FDH)
  KO
K00122  formate dehydrogenase [EC:1.17.1.9]
Organism
ani  Aspergillus nidulans
Pathway
ani00630  Glyoxylate and dicarboxylate metabolism
ani00680  Methane metabolism
ani01100  Metabolic pathways
ani01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ani00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AN6525.2
  09102 Energy metabolism
   00680 Methane metabolism
    AN6525.2
Enzymes [BR:ani01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.9  formate dehydrogenase
     AN6525.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 Shikimate_DH
Motif
Other DBs
NCBI-GeneID: 2870218
NCBI-ProteinID: XP_664129
UniProt: Q03134
Position
I
AA seq 377 aa AA seqDB search
MVLYDGGSHAKDQPGLLGTTENELGIRKWIEEQGHTLVTTSDKDGENSTFDKELVDAEVI
ITTPFHPGYLTAERLAKAKNLKLAVTAGIGSDHVDLDAANKTNGGITVAEVTGSNVVSVA
EHVVMTILLLVRNFVPAHDQIRNGDWNVAAVAKNEFDLENKVVGTVGVGRIGERVLRRLK
PFDCKELLYYDYQPLRPEVEKEIGARRVDSLEEMVSQCDVVTINCPLHEKTRGLFNKELI
SKMKPGKSALLYLIIPMLMYHKGSWLVNTARGAIVVKEDVAEALKSGHLRGYGGDVWFPQ
PAPKEHPLRYAEHPWGGGNATVPHMSGTSIDAQIRYANGTKAILDSYFSGRFDYQPQDLI
VHGGDYATKAYGQREKK
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggtcctttatgacggtggctctcacgccaaagaccagcctggtctcctcggaaccact
gagaacgagctcggcatcagaaagtggattgaggagcagggtcacactcttgtgaccacc
tccgacaaggacggcgagaactctactttcgataaggagcttgttgacgccgaagttatc
atcaccactcccttccaccccggatacctcacagctgagcgtctggccaaggctaagaac
ctcaagcttgctgtcactgccggtattggctccgaccatgtcgacttggacgctgccaac
aagacaaacggtggtattactgttgctgaggtcactggttccaacgttgtctccgtcgct
gagcacgttgtcatgaccatcctcctcctcgtccgcaatttcgtccccgcccacgaccag
atccgtaacggtgactggaatgtcgccgctgttgctaagaacgagttcgaccttgagaac
aaggttgtcggaaccgttggtgttggccgtatcggtgagcgtgtgctccgccgtctcaag
cccttcgactgcaaggagctcctctattatgactatcagcccctgcgccctgaggttgaa
aaggagattggcgctcgccgcgtggactctctcgaggagatggtctctcagtgtgatgtt
gttaccattaattgccctttgcacgagaagacccgtggtctcttcaacaaggagctcatt
tctaagatgaagcctggtaaatctgctcttttatatttgattattccgatgctaatgtat
cacaaaggttcatggctcgtcaacactgctcgtggcgctattgttgttaaggaggatgtt
gctgaggctctcaagtccggccacctccgcggctacggcggtgatgtctggttcccccag
cccgctcccaaggagcacccactccgctacgccgagcacccttggggcggtggtaacgct
actgttccccacatgtctggtacctccattgacgcccaaatccgttacgccaacggcacc
aaggccattctggacagctacttctccggccgctttgactaccagcctcaagacctgatt
gttcacggtggtgactatgctaccaaggcctacggtcagcgtgagaagaaatga

DBGET integrated database retrieval system