KEGG   Aspergillus nidulans: AN6844.2Help
Entry
AN6844.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K05605  3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
ani  Aspergillus nidulans
Pathway
ani00280  Valine, leucine and isoleucine degradation
ani00410  beta-Alanine metabolism
ani00640  Propanoate metabolism
ani01100  Metabolic pathways
ani01200  Carbon metabolism
Module
ani_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AN6844.2
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AN6844.2
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AN6844.2
Enzymes [BR:ani01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     AN6844.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-GeneID: 2870532
NCBI-ProteinID: XP_664448
UniProt: Q5AXY6
Position
I
AA seq 481 aa AA seqDB search
MPLRAKVTNPGFAATSNMSTASNPDIPKAQHGDEPDDVLFNSLFGVRLVELNRPKKLNSL
NGSMVRKILPRLKEWEKSQLANIIMVAGAGTKALCAGGDVAALALQNEKGPEGQQASTDF
FGLEYKLDHVIATYSKPFISVMDGITMGGGVGLSVHAPFRIATERTVFAMPETTIGFFPD
VGGSFFLPRLDGEIGTYLALTSARLTGVQALYAGIATHYFDSSVLGNLTQRLSELVFRDS
ATLQERLDLINRTMAEFATGLPEEPQLAGQLRSAIDRCFRHDTVEQIMKALEREKKCKKW
AQETLETMSQRSPTSLKVALRQMRVGQAWGIRETFQREYEIAARFMQHPDFVEGVKARLM
SKPPRQASWQPATLAEVSEKDVDEFFKIPQGKERIQLLSQENWRSYPHSYGLPSEKAIEK
FIREADPKSRASKGEVIEHFVKEFEHKEGVKEKVAEVLARKTTKSAEGLIWQGEGAETDG
Q
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcctcttcgcgcaaaagtgacgaacccaggtttcgcggcgacttctaatatgtcgacc
gcatccaacccagatatccccaaagctcaacacggagacgagcccgacgatgtcctcttc
aattccctattcggagtgcgactggtggagctcaacaggccaaagaagcttaactcgttg
aacggctcgatggtcaggaagattcttccacgcctcaaggaatgggaaaaatctcaactt
gccaacatcatcatggtcgctggggccggcacgaaggctctctgtgccggcggtgacgtg
gctgctcttgcactacagaacgaaaagggccccgagggacaacaggcatcgacagacttc
ttcggtctcgaatacaagctcgaccatgtcatcgcaacctactcgaaacccttcatctcc
gtcatggacggcattaccatgggcggaggcgttggactaagtgttcacgcgccattccgc
atcgcgaccgaacgcactgtcttcgccatgcccgaaacgaccatcggcttcttccccgac
gtcggcggctcttttttcctcccccgtctcgacggcgagattggcacctatctggcccta
acatcggcacgcctgaccggtgttcaggcgctgtatgctggcattgctacacactacttt
gactctagcgttttgggcaatctgacacagcgtctgtcggaattggtcttccgcgacagt
gctactctccaggagcggctagacctgatcaaccgcacaatggccgagttcgcgacaggt
cttcctgaggaaccccaactggctggccagctgcgtagcgcaattgaccgatgcttccgc
cacgatacggtggagcagattatgaaggccttagagcgggagaagaagtgcaaaaagtgg
gcacaagaaacgttagagaccatgtcgcagcggtcgccgacctccctcaaggttgctctg
cgccaaatgcgtgtgggccaggcatggggcatccgcgagacgttccagcgtgagtacgag
attgctgcacgattcatgcagcaccccgacttcgtcgagggcgtcaaggcacgtctcatg
tcgaagccgccccgccaggcgtcgtggcagcctgcaactcttgccgaggtctctgagaag
gacgtggatgagtttttcaagatcccgcaaggcaaggagcgtatccaacttttgagccag
gagaactggcgctcttacccacactcctatggtctcccttctgaaaaggccatcgagaaa
ttcattcgggaagccgacccgaagtcaagggcttcgaagggcgaggttatcgagcatttc
gtgaaggagtttgaacacaaggaaggcgtcaaggagaaggttgccgaggtgctggctaga
aagaccactaaatccgccgagggcctcatttggcaaggtgagggtgctgagacggatggt
cagtag

DBGET integrated database retrieval system