KEGG   Aspergillus nidulans: AN7000.2Help
Entry
AN7000.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
ani  Aspergillus nidulans
Pathway
ani00020  Citrate cycle (TCA cycle)
ani00640  Propanoate metabolism
ani01100  Metabolic pathways
ani01110  Biosynthesis of secondary metabolites
ani01130  Biosynthesis of antibiotics
ani01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ani00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AN7000.2
   00640 Propanoate metabolism
    AN7000.2
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ani04147]
    AN7000.2
Enzymes [BR:ani01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     AN7000.2
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     AN7000.2
Exosome [BR:ani04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AN7000.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A VID27_N
Motif
Other DBs
NCBI-GeneID: 2869988
NCBI-ProteinID: XP_664604
UniProt: Q5AXI0
Position
IV
AA seq 456 aa AA seqDB search
MFTVLRSRPVAALRAATGSSSRIAQQQRNLSIHEYLSANLLKSYGVGVPKGEVARSAEEA
EKVAKSLGNDDMVIKAQVLAGGRGKGHFDNGLKGGVRVIYSPTEAKMFAGQMIGHKLITK
QTGAGGRLCNAVFIVERKFARREFYLAVLMDRKTQGPVIVASSQGGMDIEAVAKENPDAI
ITTPIDINVGVTDAIATKIANELGFSEQCVDDAKKTIQNLYKAFMETDATQIEINPLSET
SDHQVLAMDAKLGFDDNAEFRQKEIFSWRDTTQEDADEVKAAEHGLNFIKLDGDIGCLGV
YPRPNDIIAVLTRTVNGAGLAMATMDIIKLNGGSPANFLDVGGGATPAAIKSAFELITSD
PKVSAIFVNIFGGIVRCDAIAQGLINVVQEMGLRTPIVARLQGTNMEQAHKLINESGLKI
FSIEDLQSAAEKSVQFSKVVKMAREIDVGVEFTLGI
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgttcacagttctccgcagccggccagttgcggcgctcagagctgccacgggctcatct
tcgcgcattgctcagcagcaaagaaacctctccatccatgaatacctttccgccaacctg
ctgaaatcatatggtgtgggtgtgcccaagggtgaagtcgctcggtcggcagaggaggct
gagaaggtcgccaagtcactcggtaacgatgacatggttatcaaggctcaggtccttgcc
ggtggtcgtggcaagggtcactttgataacggcctcaagggaggtgtgcgcgtgatctac
tctcccaccgaggccaagatgtttgctggtcaaatgattggacacaagctcatcaccaag
cagactggcgccggcggtcgtctttgcaacgccgttttcattgtcgagcgcaagttcgct
cgtcgcgaattctaccttgctgtcctcatggaccgcaagactcaaggtcctgtcatcgtt
gcttcgtcgcagggtggtatggacatcgaggctgtcgccaaggaaaaccccgatgccatt
atcacgactcctattgatatcaatgtcggcgtgacggatgccatcgccaccaagattgcc
aatgagctcggtttctccgagcaatgcgttgatgacgccaagaagaccattcagaacctt
tacaaggcctttatggagaccgatgctactcagattgaaatcaaccctctgtctgagact
tcagaccaccaggttttggccatggacgccaagttgggcttcgacgacaacgccgaattc
cgtcagaaggaaattttctcatggagggacaccacgcaggaggacgctgacgaggtcaag
gccgctgagcacggcctgaactttattaaacttgatggtgacattggttgcttgggtgtg
tatccccgtcccaatgatattatagcagttctaactcgtacagtcaacggtgctggtctc
gccatggccaccatggatatcatcaagcttaacggtggcagccctgccaacttccttgat
gtcggaggcggtgccacccctgctgccattaagtcggcgttcgagctcatcacaagcgac
cccaaggtttcggctatctttgtcaacatcttcggtggtatcgtccgctgcgacgccatc
gcgcagggcttgatcaacgttgttcaggagatgggcctgcgcactcctatcgtagcccgg
ttacagggaaccaacatggagcaggctcacaagctgatcaatgaatccggcctcaagatc
ttctctattgaggacctccagagcgctgcggagaagtccgttcagttctccaaggttgtc
aagatggcccgcgaaatcgacgtgggcgttgaatttactctcggtatctaa

DBGET integrated database retrieval system