KEGG   Aspergillus nidulans: AN7049.2
Entry
AN7049.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K05285  GPI ethanolamine phosphate transferase 1 [EC:2.7.-.-]
Organism
ani  Aspergillus nidulans
Pathway
ani00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
ani01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ani00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    AN7049.2
Enzymes [BR:ani01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.-  Transferring phosphorus-containing groups
    2.7.-.-  
     AN7049.2
SSDB
Motif
Pfam: PigN Phosphodiest Sulfatase Metalloenzyme PglZ
Other DBs
NCBI-GeneID: 2870192
NCBI-ProteinID: XP_664653
UniProt: Q5AXD1
Position
IV
AA seq 930 aa
MARLGRTGFLTLAVVFHLIYAYSIFDIYFVSPIVSGMRPFRVEREPGSEAPAKRLVLFVA
DGLRADKAFELTPDPDLPEESNGDDLTFLAPFIRSRVLSHGTFGISHTRVPTESRPGHVA
LIAGLYEDVSAVTTGWKLNPVNFDSVFNRSRHTWSWGSPDILLMFKEGAVPGRVDADTYG
EELEDFTSDATALDIWVFDKVKELFASAKKDPELNAKLREDKNVFFLHLLGLDTTGHGYR
PYSKEYLRNIKLVDQGIKEISQLVEDFYGDDKTAFVFTADHGMSDWGSHGDGHPDNTRTP
LVVWGSGVAPPKQPQHGVPSGHEDGVSADWHLNQVQRNDVAQADVAALMAYLVGLDFPTN
SVGQLPLEYVDGTPREKALAALANTQEVLEMYHVKEEHKKAALLRYRPFEPLASDYGNSA
EQRLAMIKDLIDRGFYEDAIETSAALFATALEGLRYLQTYDWLFLRTIVTFGYVGWIAYA
LTTVIHLHVLHGASESDRTTASISFFSSVLVALFSVFLYQGSPWRYYLYGFFPIFFWEEV
FARRKAFHAGRAGALLLPKRDLHSNKVEDIDTITYGGAFMLLTGLLYLLFEDEILGTSHQ
PAAVSRKGSRNIMGLQLGMVLLALIVTRSSAASLQAKQGLPFGNQVVGWGVLIASLLLPF
AHRLYPNSHYLHRLMIIFLTFSPTFIILTISYEGLFYFAFCMTLVTWVRLEHATYVYTAK
PVAKQAQETIEPPKKANPGATTVVDGETYRFRTLTVSDARVALFFFFLLQSAFFSTGNIA
SISSFSLDSVYRLIPVFNPFSQGALLILKLLIPFAIISANLGILNRRLEVAPSALFMVVM
AISDVMTLNFFYMVRDEGSWLDIGTTISHFCIASFLCTFVAGLEFLSEVFISGVDFGLRT
DAITASVPDIVNGITSKGQKDVPNGVEDKE
NT seq 2793 nt   +upstreamnt  +downstreamnt
atggcgcgtctcggtcgtaccgggtttctcaccctcgcggtagtgtttcatctaatatat
gcatactcaatcttcgatatatatttcgtcagtccgattgtgagtggaatgaggcccttt
cgtgtggagcgggagcccggctctgaagctccagcgaaacgtcttgtcctcttcgtcgcc
gacggattacgcgccgacaaggcgttcgaattgacaccggatccagaccttcctgaagaa
tcaaatggcgacgacttgacattccttgctcctttcattcgatcccgcgtattgtcccac
ggtacattcggaatttcccatactcgagtcccgacagaatcacggcctggtcatgttgcc
ttaatcgctggattatacgaggatgtttcggccgttacgacaggatggaaattgaacccg
gtgaacttcgatagcgtcttcaatcggagcaggcatacgtggagctggggaagtcctgat
attctcctgatgtttaaagaaggtgctgttccggggagggtcgatgcggatacatacggg
gaagaattagaggacttcacgagtgacgcaacggccctcgatatttgggtattcgataag
gtgaaggagctatttgcatcggccaagaaagatccagaattaaatgccaagttacgggag
gataagaacgttttcttcctgcatcttcttggattggacacgacgggtcatggttaccgt
ccctactcgaaagaatacctacggaatatcaaattagtcgaccagggaatcaaggaaatc
tcgcagctcgtggaggatttctacggcgatgataagacggcatttgtgttcaccgcggac
catggtatgagcgattggggcagtcacggggatggtcatcctgataacacacgaacgcct
ctggtggtgtggggatctggtgttgcaccaccaaagcagccccagcatggcgttccttca
ggacacgaagatggcgtctcagccgactggcacttaaatcaggttcaaaggaacgatgtc
gcacaggctgatgttgctgcccttatggcgtatctggtgggactcgatttccccacgaat
tctgttggccagcttcctctggaatatgtcgacgggacccctagggagaaggccttggca
gctttggccaacacacaggaggtcctggaaatgtatcacgttaaggaagaacacaagaaa
gcggctcttcttcggtaccgtccgtttgaaccacttgcgagcgactacgggaattctgct
gagcagcgtctcgcgatgatcaaagatctaattgaccgtggcttttatgaagatgcgatc
gagacatctgcggctctgttcgcaacagctctagagggcctccgctaccttcaaacgtat
gattggctcttcttgaggaccattgtcactttcggatatgtgggatggattgcctatgct
ttgacgaccgtcattcacctccatgtcctgcatggcgcctcggaatctgacaggacgaca
gccagcatcagtttcttctcctcagttcttgtggcgttgttctcggttttcctttaccag
ggctctccctggaggtattatctttatggattctttccgatatttttctgggaggaggtg
ttcgctcggagaaaggccttccacgcagggcgcgctggtgcactcctacttccaaagaga
gatttacactccaacaaggtcgaagatatcgacacaataacttatggtggggcgttcatg
cttctcaccggcttgctatacctgctttttgaggacgaaattcttggcactagtcaccag
cccgcagctgtgtcccgaaagggttcaaggaacatcatgggattgcagcttggtatggtc
ctgctcgcactgatcgtaacaagatcaagtgcagcctcgctccaagcgaagcaaggtctt
ccattcggcaaccaggtagtcggatggggcgtcctcattgcttcacttttattgccgttc
gcccaccgactatatcccaatagccactacttacatcggctaatgatcatcttcctgaca
ttctcaccgacctttataatcctcaccatatcttacgaaggtttattctactttgcattc
tgcatgaccctggttacttgggtccggttggagcatgctacgtacgtctacaccgcgaaa
cctgtcgccaagcaggcgcaggagaccattgagccgcccaaaaaagcaaacccgggtgcc
acaacagttgtggatggcgaaacataccgcttccgcacactcaccgtttcagatgcacgc
gtagctttgttctttttcttccttctgcaatcggcttttttcagcactggaaatatcgcc
tcgatctcctccttctctttggacagcgtgtaccgactcattccggtgttcaatcccttt
agccagggcgcgttattaatcctcaagctccttatcccgttcgctatcattagtgcgaac
ctgggcatcctcaaccgtcgcctggaagtggcacctagtgccctattcatggtggtgatg
gccatttccgatgtcatgactttgaactttttctacatggtccgggacgagggctcttgg
ctcgacatcggaactaccatcagtcatttctgcattgctagtttcctgtgcacgtttgtt
gccggtcttgagttcctcagcgaggtgttcatcagtggtgtggactttggactccgtact
gacgcgattactgcatctgtccccgacattgtcaatgggataacttctaaaggccaaaag
gatgttcccaatggcgttgaggataaagaatga

DBGET integrated database retrieval system