KEGG   Aspergillus nidulans: AN7825.2Help
Entry
AN7825.2          CDS       T01016                                 

Definition
(RefSeq) STCA_EMENI Putative sterigmatocystin biosynthesis polyketide synthase (PKS)
  KO
K15316  noranthrone synthase [EC:2.3.1.221]
Organism
ani  Aspergillus nidulans
Pathway
ani00254  Aflatoxin biosynthesis
ani01100  Metabolic pathways
ani01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ani00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    AN7825.2
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:ani01008]
    AN7825.2
Enzymes [BR:ani01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.221  noranthrone synthase
     AN7825.2
Polyketide biosynthesis proteins [BR:ani01008]
 Polyketide synthase (PKS)
  Iterative type I PKS
   Fungal nonreducing PKS (NR-PKS)
    AN7825.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ketoacyl-synt SAT Thioesterase Acyl_transf_1 Ketoacyl-synt_C PP-binding PS-DH KAsynt_C_assoc Abhydrolase_6 Thiolase_N
Motif
Other DBs
NCBI-GeneID: 2869640
NCBI-ProteinID: XP_681094
UniProt: Q12397
Position
IV
AA seq 2238 aa AA seqDB search
MASHAEPTRLFLFGDQTYDFVADLRDLLNIRNNPILVAFLEQSHHVIRAQMIRELPPKEH
KQARTASLAELLQKYVDRKLPSAFQTALSCVTQIGLFMRQFDDPRVLYPHANDSYVLGVC
TGSLAAAAISCSTSLSELLPIAVQTVLVAFRLGLWAEKVRDNLEISETNQTQPWSAVCHV
PPEEVAIAIDRFSHKKVRSPVYRAQRPWITATSAKTTTVSASPDILSQLASQAPFTNSKL
WREIPIYVPAHNNHLFSSRDVDDILATTNENPWSTFGAQIPFLSSVTGKLAWVRNYRDLL
HLALSQCLIEPIRWDVVEAEVPRLLKDRDGLDTLTIVAFTTVLSKSLSNALVTEGIKPAE
PPTSINKTPERYSHRPGSDRGKLAIVSMSGRFPEAPSTDSFWDLLYKGLDVCKEVPLRRW
DVKTHVDPSGKARNKGATRWGCWLDFAGEFDPRFFSISPKEAPQMDPAQRMALMSTYEAM
ERGGIVPDTTPSTQRNRIGVFHGVTSNDWMETNTAQNIDTYFITGGNRGFIPGRINFCFE
FSGPSYSNDTACSSSLAAIHLACNSLWRGDCDTAVAGGTNMIFTPDGHTGLDKGFFLSRT
GNCKAFDDAADGYCRAEGVGTVFIKRLEDALAENDPILATILDIKTNHSAMSDSMTRPFK
PAQIDNMSALLSTAGISPLDLSYIEMHGTGTQVGDAVEMESVLSLFAPDETFRPRDKPLY
VGSAKANIGHGEGVSGVTSLIKVLLMMKNDTIPPHCGIKPGSRINRNYPDLPARNVHIAF
EPKPWPRTDTPRRVLINNFSAAGGNTAVLVEDAPVRDPVTASDPRTSHIVTVSGHVGKSL
KLNLEKLRDHLVKRPEINPSELSYTTTARRWHHPHRVSITGANTMEILRNVESAIARGHG
VNRPATKPKIVIACSGQGSQYTGMGWQLYNSYPTFRSDLERFDQLARSYGFPSFLEVYTS
KPVGDSMEDLLPVIVQLALVSLEMALGNLLGSFGLKPSAVIGHSLGEYAALYISGVLSAA
DTLYLVGMRAKLLQERCQRGTHAMLAVRASPVTLCEVLAESNCEVACHNGPNDTVLSGPL
KEVMNLQNSLSATGIKGTLLKLPFAFHSAQVQPILEEFKNVARGVTFHKPQIPVLSPLLV
KVIDEKGTVDPVYLARHCREPVKMVSVLEHARDQHIITDRTIVIDVGPKALMAGMIKTTL
DKDTSSALPTLGPSLDVWKSLTNILGTLYSRGLDINWVAYHEPFGSAKKVIELPSYGWDL
KDYFIPYKGEWCLHRHEIRCSCATPGKETATSDYQLPSDEQVAAKRPSKQDESKEAYPEI
VATTTVHRVVEEKTEPLGATLVVETDISRPDVNQIAQGHLVDGIPLCTPSVYADIALHVG
RYSMNRLRASHPGAMDGVVDVADMVIDKALIPHGKSPQLLRTTLTMTWPPKAAATTRSAK
IKFATYFADGKLDTEHATCTVRFTSEAQLKSLQKKVPEYQERIKKLGEGLRQGQFIRYTT
KSGYKLMSSMASFHRDYKLLNHLILNEADNEAVSTMDFSAAKSEGTFAAHPAYVDAITQV
GGFAMNANDNTDIQQEVFVNHGWDSFQVYQPLVKGKTYEVYVRMTEDEKGDLVHGDTIVL
YGDAVVAFFKGLSLRRVPRRGLRMVLQQASDKAARLHGNQQAVKTQAPQRAALKQKPQSS
PTQPHASKVAYSRSATSPTAGKPVVAARDLSREGDDKFKAVLSVISEESGVALGELTADT
NFADIGIDSLSSMVIGSRLREDLGLELGAEFSLFIDCPTVRSLKTLLSGSAVSVNNDKDE
LEPGQEAETAAPEQLDLRIGDAAPSKVRDANIEPLDLGDELFRNVLRIVSEESGVALDEL
SAETVFADIGIDSLSSMVITSRFREDLGMSLDSSFNLFEEVPTVARLQEFFGTTSGSTTG
SSGSGSSEDETDSIPSTPEEYTTADTRVPECRPTTSVVLQGLPQMAKQILFMLPDGGGSA
SSYLTIPRLHADVAIVGLNCPYARDPENMNCTHQSMIQSFCNEIKRRQPEGPYHLGGWSS
GGAFAYVTAEALINAGNEVHSLIIIDAPVPQVMEKLPTSFYEYCNNLGLFSNQPGGTTDG
TAQPPPYLIPHFQATVDVMLDYRVAPLKTNRMPKVGIIWASETVMDEDNAPKMKGMHFMV
QKRKDFGPDGWDVVCPGAVFDIVRAEGANHFTLMSNCLPTSHLNRKAEDSLELESSLVPI
SSRRRGKPNIEWSVDSAE
NT seq 6717 nt NT seq  +upstreamnt  +downstreamnt
atggccagtcacgctgagccaaccaggctcttcctttttggggaccagacctatgacttc
gttgcagatttgcgagatcttctcaatattcgcaacaatccaattctagtggcctttctc
gaacaatcgcaccatgttatacgtgcccagatgatccgcgagctgccaccaaaagagcac
aagcaagctcggactgcgtccttagcagagttactgcagaaatatgtcgatcgaaagctg
ccgtctgctttccagactgccctctcctgcgttactcagatagggctatttatgcgtcaa
tttgatgacccgcgtgttctttacccacacgctaacgacagctacgtcttgggagtctgc
acaggatctcttgcggcagccgccattagctgcagtacttctttatctgagcttttacca
attgctgtccagaccgtcctcgtcgcctttcgccttggcctttgggcagagaaagtgcgc
gataaccttgaaatatccgaaaccaaccaaacacagccctggtcggcagtgtgtcatgtt
ccaccggaggaggtggccattgccattgacaggttcagtcataaaaaggtccgtagccct
gtataccgtgctcaaagaccctggattactgcaacatcagccaaaactacgacagttagc
gcaagccctgatatcttgagccagttggctagtcaagcacccttcacgaatagcaaactg
tggagggagattccaatctacgttcctgcgcataacaaccatttgttctcctcaagggat
gtcgacgacatcctggcgaccacgaatgagaacccctggtccaccttcggcgcccaaata
ccgttcctgtcctccgtcactggaaagttggcttgggtccgaaactaccgtgacctccta
catctggccctctcgcaatgccttatcgaacctatacgatgggacgtcgtcgaggcagaa
gtgccgcggctcctcaaagaccgtgatggtctcgatacgctgacaattgtagccttcaca
accgtgctttctaaaagtttgtccaatgctctggttaccgaaggaataaagccagcagaa
cctccgacctctataaataagaccccggagcgatatagccaccgtccagggtctgacaga
ggcaaactggcgattgtgtctatgtctggtcgatttcccgaggccccttctaccgattca
ttctgggatctgctttacaaaggccttgacgtttgtaaagaggtccccttgcgtcgatgg
gatgtaaagacccatgttgatccgagcggcaaagcgcgcaacaaaggggccacacgttgg
ggttgctggcttgactttgctggtgaattcgacccacgcttctttagcatctcgcccaag
gaggcgccgcaaatggatccggcccagaggatggcattaatgtcaacttacgaagccatg
gagcgaggaggcattgtgccagacacgacaccgtcaactcaacgtaaccgcatcggagtt
ttccacggcgttaccagtaatgactggatggaaacgaataccgcgcaaaatatagacacc
tactttatcacgggcggaaacagggggttcattcctggtcggatcaatttctgctttgaa
ttttcagggcccagttatagtaatgacactgcatgttcctccagtctggcagctattcat
ctcgcatgtaattccctgtggcgtggtgactgcgatactgcggtggctggaggcacgaat
atgatttttacccctgatggacatactggcctggataaggggtttttcctttctcgaaca
ggcaactgcaaggcttttgacgatgcagcagatggctattgccgtgcggaaggagtcggt
accgtcttcatcaaacgtcttgaggatgcattagcagaaaatgatcctattctggccact
atcctcgacatcaaaacaaaccactcggccatgtcggactcaatgacacggccgtttaag
cctgcgcagattgacaacatgtcggctttattgagtacagccggaatcagcccgcttgac
cttagctatatcgaaatgcacggtaccgggacgcaggtgggtgacgccgtcgaaatggag
tcggttctgagtctctttgctccggacgagacatttcgaccccgagataaaccgttgtac
gtgggatctgccaaagcgaacattggccatggagaaggagtttccggcgtcaccagtctc
atcaaggtcctactgatgatgaaaaacgacaccattcctcctcactgtggcattaaaccg
ggaagccgaatcaaccggaactatccagaccttccagctcgcaatgtgcatattgctttt
gagccaaaaccgtggcctcggacagatacacctcgacgtgtgctcatcaacaactttagt
gccgctggagggaacaccgctgtcctggttgaggacgctcctgttcgtgatcccgtaact
gcatcagatccccgaactagccacattgttactgtttctggccacgttgggaagtccctc
aagctgaacttggagaaattgcgggatcatttggtgaagcggccggaaatcaatccttcg
gagctctcatatacgaccactgcccggcgatggcaccaccctcatcgggtgagtataaca
ggagctaacactatggaaatcttgcgcaatgtagaaagcgctatagcaagagggcatgga
gtcaaccgccccgcaactaagccgaaaattgtcattgcttgtagtgggcaaggctcccag
tacacagggatgggctggcagctatacaacagttatccgactttccggtctgacctagag
cgatttgatcaattggctaggagctatgggtttcccagtttccttgaggtctacacctcc
aagccagtcggcgacagcatggaagatctcctccccgttattgtccaattggctttggtg
agtcttgaaatggctttgggaaaccttctgggctccttcggtctgaaaccaagtgcagtc
attggccatagtcttggcgaatacgcggcattatacatcagcggcgttctttcagctgcc
gatacattgtacttggttgggatgagagcgaagctgcttcaagaacgctgtcagcgaggc
acccacgcgatgctcgccgttcgagcatcaccggtcacgctgtgtgaagtattggccgaa
tccaactgtgaagtagcctgtcataatggccctaacgacactgttttgagtggaccactt
aaggaggttatgaaccttcagaattccctgtctgcgacaggtatcaaaggtactttactg
aagctgccatttgccttccattctgctcaggttcagcctattctagaagagttcaagaac
gtggcccgtggtgtgaccttccacaagccacagataccagtattgtctcctcttttggtt
aaggtgatcgatgaaaagggcaccgtggatccagtttacctcgcccgccattgccgggag
ccagtcaagatggtgtcagtccttgaacatgctcgcgatcagcatatcatcacagatcgc
acaattgtcattgacgttggacccaaggcattaatggctggaatgataaagacgacactt
gataaggacaccagttcggctctgccaactctgggacccagtctagacgtttggaagagc
ctgactaatatcttgggtacgttgtattcacgagggttggatattaattgggttgcgtat
cacgagccgtttggatctgcgaagaaagtcatcgaactcccttcttacggctgggacctg
aaagattacttcatcccatacaagggtgaatggtgtttacaccgccatgaaattcgttgc
agctgcgcgactccagggaaggagactgcaacgagcgactaccagcttccttcagatgag
caggtcgcagctaagaggccttcaaaacaagatgaaagcaaggaagcatatcccgagata
gtggccactacaacagtgcaccgtgtagtggaagagaagactgagccacttggggctact
ctggtagtagagaccgatatctctcgcccagacgtgaaccagattgctcaaggtcacctg
gtggatggaataccactgtgtaccccgtcagtatatgcagatatcgcccttcatgttggg
aggtattccatgaaccgccttcgagcaagtcaccccggcgccatggacggtgttgtcgac
gttgccgacatggtaatcgacaaggcccttattcctcatggcaaatcgccacagctgctt
cggacgacgctgactatgacatggccgccgaaggctgcagctaccacacgttccgcgaaa
atcaagtttgctacctacttcgccgatggcaagcttgatactgagcacgcgacttgcact
gttcgcttcacaagcgaggcgcagctcaagtcattacagaaaaaagtacccgaatatcag
gaacgaataaagaaattaggagagggccttcgccagggccagttcattcgatatacgacc
aagagcggatacaagttgatgagcagcatggccagtttccatcgtgactacaagctcctg
aaccatctgatcctgaacgaggcggacaatgaagcggtctcgacaatggatttctccgca
gccaagagcgagggcacattcgctgcgcacccggcatatgttgatgccattactcaggtt
ggcggctttgctatgaatgccaacgacaatacggatatccaacaggaagttttcgtaaac
catggatgggactcgttccaggtttaccagccgctcgtcaagggcaagacttatgaagtg
tatgtgcggatgacagaggacgagaaaggagatcttgttcatggcgataccattgtgctg
tatggcgatgctgttgttgcattctttaaagggctttcgctccgccgtgtcccccgaaga
ggccttcgaatggttctgcagcaggcgtccgacaaggcagctcgtctacatgggaatcaa
caagccgtcaaaacccaggcaccacagcgtgcagctcttaaacaaaaaccccagtcgtca
ccaacacagccgcatgcatcaaaggtggcttactcaagatcagcaacctcgccaacggct
ggaaaaccagtggtggctgcgagagacctatcgcgagaaggagatgataaattcaaggcc
gttttgagcgttatatctgaggagagtggtgttgcgttgggagaactcacagctgatacc
aattttgctgacatcgggatagactctcttagctctatggtcattggtagcagactacgt
gaggaccttggccttgaacttggagccgaattctccttgtttatcgactgcccgactgtc
agatccctcaaaacgcttctctctggatcagcggtaagtgtgaataacgacaaggatgag
ctggagcctggtcaagaagcagagacggcggcgccagagcaactagacttacgcattggg
gacgccgcgcccagcaaagttagagatgccaacatcgagccactcgatcttggggatgag
ctgttccggaacgtgctcagaatcgtttcggaagagagcggagtggcgctcgatgagttg
agcgctgagactgtctttgctgacatcggcatcgattcgctgagctccatggtgataacg
agccgcttccgtgaagaccttgggatgtctctggactcgtcgttcaacctatttgaggaa
gtaccaacagttgcacgcctacaagagttctttggcaccacaagcggaagcacgaccggt
tcgtcaggctcgggcagctctgaggacgagaccgatagcatcccatcgactccggaggaa
tacactaccgcagatacccgggtccctgaatgccgtccaaccacttcggtagttcttcag
ggtcttccccagatggccaaacagatcctgttcatgctccccgacggcggcggatcggca
tcttcgtacctcacaatcccgcgtctccatgccgacgtagccatcgtcgggctgaactgc
ccctacgcgcgagaccccgaaaacatgaactgcactcaccagtccatgatccagagcttc
tgcaacgaaatcaaacgtcgccagccagaaggcccataccatctcggcggctggtcctcc
ggtggcgccttcgcctatgtaacagccgaagccctcatcaatgcaggcaacgaagtccac
tcgctaattataatcgacgcacctgtcccacaagtgatggaaaaacttcccacctcgttc
tacgagtactgcaacaacctcggtctcttctccaaccagcccggtggcacaacagacggc
accgcgcagcccccgccatatctaatcccgcatttccaggccactgtcgacgtgatgctc
gactaccgtgttgcgccgctgaaaaccaaccgcatgccaaaggtaggtattatctgggcg
tctgagacggtgatggacgaggacaacgcgcccaaaatgaaagggatgcactttatggtg
cagaaaaggaaggattttgggccggatgggtgggatgtggtttgtccgggggcggtgttt
gatattgtgcgcgctgaaggggcaaatcattttacgctgatgagtaattgtttacccacc
tctcacttgaacagaaaagccgaagattctttggaacttgaaagttctctggtacctatt
agtagccggcgccgtggtaaacctaacattgaatggtccgtggacagtgctgagtag

DBGET integrated database retrieval system