KEGG   Aspergillus nidulans: AN7866.2
Entry
AN7866.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
Organism
ani  Aspergillus nidulans
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-GeneID: 2869077
NCBI-ProteinID: XP_681135
UniProt: Q5AV14 A0A1U8QHF4
Position
II
AA seq 523 aa
MAVEKPAEHANIEALTRADSADAPVDSRAKSALASDNIFEHEQTVLQVLRGHPVLIWWAF
FFSVSAIGWGFDAQVNGAVLSIPSFRRDFGEHFEGDFVVPAPWLSAFNSISSVGQFFGGF
LCSAVADRVGRRLALAVGVMISCGGIFGELFSTARVAFLISKLILGVGLGFYLTIGPLYS
SEVSPVVLRGITTAGVNLGIVIGQLLSNAAIKGFGERGDRWAYRGPFAIQFFFVVFLGLG
LPFSVESPWYLVRHNRIDDARNALQRLYGAGTNVDTKLVAIRMTVAQDLAARESKWSYAI
RGPNLLRTTISCGVFVCQHLVGIIFVLGFSAYFFQLAGLPTERSFDLGVGVTACGVVGTI
ISWLIVNRLGRRLIFNSGMAILSTINLLIGILDVVPTSGASWTQAALTVVWAFFYQVSIG
AVAFVLLGETSSPSLRAKTTAMATATQAVFGIVMNIVIPYMVNPDEGNMQGKVGFVFGGL
GVVATVLCYLYIPDLKDRTFEEIDLMFETRVAPRNMGRYVIER
NT seq 1572 nt   +upstreamnt  +downstreamnt
atggcggttgagaagcccgctgagcacgccaatatcgaggccctcacccgggccgactca
gctgatgcgccggtcgattctagggctaaatcagccctcgcgagcgacaatatcttcgag
catgagcagactgtcttgcaggttcttcggggtcatccagtccttatttggtgggcgttt
tttttcagcgtcagtgcgatcggatgggggtttgacgctcaggtcaacggggcagtgctc
tccattccttctttccggcgtgattttggcgagcactttgaaggagacttcgtagttcct
gccccatggttgagcgcctttaattcgatctcatctgtcggacagttctttggcggtttt
ctctgcagcgccgttgccgaccgagtcggccgaaggctggctttggcggttggagtgatg
atctcttgcggaggcatctttggggaattattctcaaccgctagggttgcatttcttatt
agcaagctgattctaggagttggcctgggcttctacctaaccatcgggccgctgtactct
tccgaggtctcgccagtcgttctgcgaggtattacaactgcaggggtgaatctgggcatc
gtgatcggccagttactctccaacgcggccatcaagggctttggcgagcgaggcgaccgg
tgggcgtacaggggcccgttcgccatccaattcttcttcgtggtgttcttgggcctaggg
cttccattttccgtcgaatccccgtggtacctcgtccgtcataacaggatcgatgacgcg
agaaatgccctgcagcgactctacggcgccggcacaaacgtcgacacgaaactcgtggct
atacgaatgacagtggcccaggacctcgcagcgagagaatccaaatggtcgtatgctatc
cgtggcccgaatctccttcggacaaccatatcctgcggcgtctttgtttgccagcacttg
gtcggcatcattttcgtgctcggcttctctgcatatttcttccagctagcaggtctgcct
actgagcggtcctttgaccttggagtcggcgtcactgcctgcggtgttgtgggcaccata
atctcgtggttaatcgtcaatcgcctgggtcgccgcctcatcttcaactctgggatggcc
atcctcagcacgatcaatctcctcattgggattcttgacgtcgttccgacgagcggggct
agttggacacaggctgcgctcacagtcgtctgggccttcttctaccaagtcagcattggc
gccgttgcctttgtccttctcggcgaaacctcgtccccgtcgctgcgagctaagacgacc
gccatggccacggcgacccaggccgtatttgggatcgtcatgaacatcgttattccctac
atggtgaatcccgatgaaggcaacatgcagggcaaagtcgggtttgtctttggagggctg
ggcgtggttgcgacggtgctctgttacttgtatattccggatctgaaggatcggaccttc
gaggaaatcgacctcatgtttgagacccgcgtggcgccacgaaatatggggagatatgtg
attgagcgctag

DBGET integrated database retrieval system