KEGG   Aspergillus nidulans: AN7869.2Help
Entry
AN7869.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K01210  glucan 1,3-beta-glucosidase [EC:3.2.1.58]
Organism
ani  Aspergillus nidulans
Pathway
ani00500  Starch and sucrose metabolism
ani01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ani00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AN7869.2
Enzymes [BR:ani01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.58  glucan 1,3-beta-glucosidase
     AN7869.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pectate_lyase_3 End_N_terminal
Motif
Other DBs
NCBI-GeneID: 2869207
NCBI-ProteinID: XP_681138
UniProt: A0A1U8QQQ5 Q5AV11
Position
II
AA seq 703 aa AA seqDB search
MLVRGLLPTSLVFGLLPNAVAISTGQSAGSGIHYRHGQQSRQAELVSRASFPKLRRQSSN
TSIEVGEQPEFWLESIAYQGISPLGPSGYTVFRNVKDFGAKVAGAAARAAFRAPRRPIVY
FPAGTYVISASIFDYYNTIITGDPNALPALKASARFEGGYLIEGTPYFGPTLNWPATTVF
WRQLRNLILDTTDVAAETQISGSAGFAGNIVFNGGKIAAALGNQQFTMRNLTFNHAKTAI
NHSWNWGWTYQDLSTNDCEVGIDISTGGSDKQALAPSRFSTAPSEHTRRAVRVVHAAHFK
QHHTGKQGPAGMVLGGSSGTSVIAGWGQGNQYVPAGPTRFAGDITAVSRPAGLLDGGKYY
QRSKPQYESLSVSPFSSVREGGATGDGTTDDTDALQNVIDAAAVSDKIVLIDAGVYKVTK
ALRIPANSRIVGDAFPVILSSGEFSKPGAAQACGAGRAARVPADKQGVCQNTGHGDYESQ
QGLHCSLYAHPRHPLSFQSVHGEYLALGFLTKRGRQSQITLYSGRGLNIESTTGNIWLSG
TSVEHSVLYKYQFVSTKNVHMGQIQTETAYYQSLPNALIPFAPNPSIHDPDITSSCDGRT
GNCAIGWGLRIVDSRDLAVYGAGLYSFFDNYDTECSAYGGYQDCQNSIFSIEGEVTILVS
SPTTSRILRAKLDRLVLERYVAPLDASDLEDNPSAPLAAWPYV
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgcttgtccgcggtcttctcccaacctcgttggtctttgggctactccccaatgccgtt
gcgatttcaacaggccaatctgccggtagcggcatacattatcgacatggccaacagagt
cgccaggcggagctggtgagtcgcgcttccttcccaaagctgcgcaggcagagctccaac
acgtccattgaagttggggagcaacctgagttctggctcgagtccatcgcataccagggt
atttcgcctctaggaccctcaggatatacagttttccgcaatgtcaaagattttggagcg
aaggtggcgggcgctgcggcgagggctgcttttcgagcaccacgacgcccgatcgtctac
ttccctgcgggcacgtacgtgatctcggcttctatcttcgactactacaataccattatc
actggagatcccaacgcgctgcctgctctaaaagcctcagctaggttcgagggtggatat
ttgattgaagggactccgtatttcggtccgacgctgaactggcccgcgactactgtattc
tggagacagttgcgcaacctcattctagacactacggacgtcgccgcggaaacgcagatc
agtggttctgctggattcgccggtaatatcgtcttcaatggaggcaaaattgcggcagcc
ctgggaaaccagcagttcaccatgcgcaacctgaccttcaaccacgctaaaactgccatc
aaccactcttggaactggggctggacataccaggacctcagcaccaacgactgcgaggtt
gggattgatatttcgactggcggcagcgacaaacaagcgttggctccatcacggttttcg
acagctccttcggaacacacccgtcgcgcagtccgagtcgtccatgccgcacatttcaag
cagcatcatactggaaaacagggacccgctggcatggttctagggggtagttcaggaact
tctgttattgcgggctggggccagggcaaccagtacgtccctgctgggcctaccagattt
gccggtgacatcacggcggtttcgcgtcctgcaggattgttggacggcggaaagtattat
caacgctccaagccacagtacgagtctctttctgtctcgccattctccagcgtccgggaa
ggaggcgccaccggtgatggaaccacggacgataccgatgcgctgcagaatgtcattgat
gctgctgccgtatctgacaagatcgtcttaatcgatgctggcgtttacaaagtgacgaag
gcattgcgcatccctgcaaattccaggattgtcggcgacgcattcccagtcatcctgtcg
agcggcgagttctccaaaccaggagcagcccaagcctgtggtgcaggtcgggcagccagg
gtcccagcagacaagcaaggagtgtgccaaaacaccggacacggtgattacgaaagccaa
caaggactgcattgtagcctatatgctcatccacgtcatcccctcagcttccaatctgta
catggagaatacctggctttgggttttctgaccaaacgaggccgccagagccagatcacg
ctctacagcggacgtggtttgaatatcgagagcacaacgggaaacatctggctgtccggc
acctctgtcgaacacagcgtgctctataagtaccagttcgtttccaccaagaacgtgcat
atgggacagatccaaacagagacagcgtactatcaaagcctccctaatgctctgattcct
ttcgcgcctaatccctcaatccacgaccccgacatcacctcaagctgcgatggccgcaca
gggaactgtgctattggctggggtctccgaatcgttgactcgcgagatctcgccgtgtac
ggcgccggcttgtattccttctttgataactatgacacagaatgctccgcgtacggcggt
tatcaggattgtcagaactccattttcagcatcgagggagaagtgacaatattggtgtct
tcaccaacaacatcgcgtattttaagggctaagttggaccggcttgtccttgaacggtac
gttgcaccgttagacgcttcagacttggaggacaatccctcggcaccccttgcagcctgg
ccctatgtgtaa

DBGET integrated database retrieval system