KEGG   Aspergillus nidulans: AN8012.2Help
Entry
AN8012.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K00787  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
ani  Aspergillus nidulans
Pathway
ani00900  Terpenoid backbone biosynthesis
ani01100  Metabolic pathways
ani01110  Biosynthesis of secondary metabolites
Module
ani_M00367  C10-C20 isoprenoid biosynthesis, non-plant eukaryotes
Brite
KEGG Orthology (KO) [BR:ani00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AN8012.2
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:ani01006]
    AN8012.2
Enzymes [BR:ani01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     AN8012.2
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     AN8012.2
Prenyltransferases [BR:ani01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   AN8012.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: polyprenyl_synt RNase_H2-Ydr279 Transposase_mut
Motif
Other DBs
NCBI-GeneID: 2869054
NCBI-ProteinID: XP_681281
UniProt: Q5AUL8 A0A1U8QGN7
Position
II
AA seq 347 aa AA seqDB search
MPSTTSRAAFEAVFPSLAEAMLDHARKYNLPQNAQEWFSKAIHTNVPGGKLNRGLSVPDT
GVALLQKELSEEQYKDLATLGWLTELLQAFFLVSDDLMDGSITRRGQPCWYRHQGVGLIA
INDAFLLESGIYVILKKQFRSHPAYVDFIELFHETTWQTELGQLCDLITAPEDKVDLNNF
SMEKYMFIVTYKTAYYSFYLPVALALHYLQLATPENLRQAHDILIPLGQYFQVQDDYLDA
YGDPEVIGKIGTDIQDNKCSWLVNQALQRCSAEQRKVLDAAYGRKDAEQEAKVKAIFREL
DLESVYKEYEEKIVGELKTKIAAVNESEGLKKEVFEAFLGKIYKRSK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgccatctactacaagccgcgctgccttcgaggcggtcttcccctccctggctgaggcc
atgcttgaccatgcgaggaaatacaacctgccccaaaatgctcaggaatggttcagcaag
gccattcacaccaacgtccctggcggcaagctcaaccgcggtctctctgtccccgacacc
ggcgtggccctcctgcagaaggaactgagcgaggagcaatacaaggaccttgctacactt
gggtggctgaccgagctgctccaggccttcttcctcgtcagcgatgaccttatggatggt
tcaatcacccgtcgcggccagccctgctggtaccgccaccagggggtcggtctcattgcc
atcaacgacgctttcctccttgagtccggtatctacgttatcctgaagaagcaattccgt
tcacaccctgcctacgtcgactttattgagctgttccatgagaccacctggcagacggaa
ttgggccagctgtgtgatctgatcacggcgcccgaggacaaggtcgatctcaacaacttc
tccatggagaagtacatgttcattgtcacctacaagaccgcctactatagcttctacctc
ccggttgccctggccctccactaccttcagcttgctacccccgagaacctccgtcaggct
cacgacatcctcattccgctcggccaatacttccaggtccaggatgactacctcgatgcg
tacggcgaccccgaggtcattggcaagatcggaacagatatccaggacaacaagtgctct
tggttagtgaaccaggctctgcagcgctgcagtgccgagcagcgcaaggtgctcgacgct
gcctatggtcgtaaggacgctgagcaagaggccaaggtcaaggctattttccgggaattg
gacctcgaatccgtctacaaggagtacgaggagaagatcgtgggtgagctgaagacgaag
atcgcggctgtcaacgagtcggaggggttgaagaaggaggtttttgaggcattcctcggg
aagatctacaagcgcagtaaataa

DBGET integrated database retrieval system