KEGG   Aspergillus nidulans: AN8041.2
Entry
AN8041.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
ani  Aspergillus nidulans
Pathway
ani00010  Glycolysis / Gluconeogenesis
ani01100  Metabolic pathways
ani01110  Biosynthesis of secondary metabolites
ani01200  Carbon metabolism
ani01230  Biosynthesis of amino acids
Module
ani_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ani_M00002  Glycolysis, core module involving three-carbon compounds
ani_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ani00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AN8041.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN8041.2
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ani04147]
    AN8041.2
Enzymes [BR:ani01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     AN8041.2
Membrane trafficking [BR:ani04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    AN8041.2
Exosome [BR:ani04147]
 Exosomal proteins
  Proteins found in most exosomes
   AN8041.2
SSDB
Motif
Pfam: Gp_dh_N Gp_dh_C 2-Hacid_dh_C
Other DBs
NCBI-GeneID: 2868966
NCBI-ProteinID: XP_681310
UniProt: P20445
Position
II
AA seq 239 aa
MAPKVGINGFGRIGRIVFRNAIEAGTVDVVAVNDPFIETHYAAYMLKYDSQHGQFKGTIE
TYDEGLIVNGKKIRFHTERDPANIPWGQDGAEYIVESTGVFTTQEKASAHLKGGAKKVVI
SAPSADAPMFVMGVNNETYKKDIQVLSNASCTTNCLAPLAKVINDNFGIIEGLMTTVHSY
TATQKVVDGPSAKDWRGGRTAATNIIPSSTGAAKAVGKVIPSLNGKLTGMAMRCRQEGF
NT seq 720 nt   +upstreamnt  +downstreamnt
atggctcccaaggtcggaatcaacggcttcggtcgtattggacgcatcgttttccgtaac
gccatcgaggcgggtaccgtcgatgttgttgccgtcaacgaccctttcatcgagacccac
tacgctgcctacatgctcaagtatgactcacagcacggtcagttcaagggcaccattgag
acctacgacgagggtcttattgtcaacggcaagaagatccgcttccacaccgagcgtgac
cccgccaacatcccctggggccaggacggtgctgaatacattgtcgagtccaccggtgtc
ttcactacccaggagaaggctagcgctcacctgaagggtggtgccaagaaggttgtcatc
tctgccccatctgctgatgcccctatgttcgtcatgggtgtcaacaacgagacctacaag
aaggacattcaggtcctctccaacgcttcttgcaccaccaactgccttgcccctctcgcc
aaggtcatcaacgacaacttcggtatcatcgagggtctgatgaccaccgtccactcctac
actgctacccagaaggtcgtcgacggcccctcggccaaggactggcgtggtggccgtacc
gctgctaccaacatcatcccctcctccactggtgctgccaaggctgtcggcaaggtcatt
ccttcgctcaatggcaagctcaccggcatggcgatgcgatgccgtcaagaaggcttctga

DBGET integrated database retrieval system