KEGG   Aspergillus nidulans: AN8203.2
Entry
AN8203.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K01950  NAD+ synthase (glutamine-hydrolysing) [EC:6.3.5.1]
Organism
ani  Aspergillus nidulans
Pathway
ani00760  Nicotinate and nicotinamide metabolism
ani01100  Metabolic pathways
ani01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:ani00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    AN8203.2
Enzymes [BR:ani01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.1  NAD+ synthase (glutamine-hydrolysing)
     AN8203.2
SSDB
Motif
Pfam: CN_hydrolase NAD_synthase
Other DBs
NCBI-GeneID: 2869198
NCBI-ProteinID: XP_681472
UniProt: A0A1U8QJ71 Q5AU27
Position
II
AA seq 678 aa
MGRLITLATCSLNQWALDWEGNCERIIESIRQAKAAGATLRVGPELEITGYGVLDGFLEG
DTFLHSWEMLARIIDHPDCQDIVVDVDGNYREMRHFTPWQRPREVEDYYLEQIVGKITGQ
YKVPFGDAVISTRDTCLGLETCEELFTPNGPHIPYSLAGVEIISNSSGSHHELKKLDTRV
NLITQATKLSGGIYLYANQQGCDGDRLYYDGCAMIVINGNIVAQGSQFSLNDVEVVTATV
DIEEVRTYRASTSRNMQASRQPPFVRLDLDTRLSRSDEDADPGIAPSETLIPRYHAPEEE
IALGPACWLWDYLRRSGAAGFFLPLSGGIDSCATAVIVHSMCREVIKAVQQGNEQVIKDV
RRLCAEPAGSTWLPTTSQEVCNFMGTQNSSKETRDRAKELAAEIGSYHIDFNFDTVVTAL
MNLFTVVTNFQPRFKVHGGSRAENQALQNIQARLRMVLSYLFASLLPTVRQRPGGGGLLV
LASSNVDECLRGYLTKYDASSADLNPIGSISKVDLKKFIGHCATSFDMPILTSFLNATPT
AELEPITATYVQSDEADMGVTYAELGTFGYLRKVSKLGPWSMYERLLHMWGNEYSPREIY
EKTRHFFYNYAINRHKMTVITPSYHAEQYSPDDNRHDLRQFLYPPFTWAYKKMEESVKYW
EERGWTTGKAQKKSVKAD
NT seq 2037 nt   +upstreamnt  +downstreamnt
atgggtcgtctcattacgctggcaacatgttccttgaaccagtgggctcttgactgggaa
ggaaactgcgagaggattattgagagtattcgccaagccaaagccgccggagccaccctt
cgcgtcggtccagagctcgaaatcaccggatatggcgttctcgacgggttcctggaggga
gatacatttctccactcatgggagatgctagcccgtattattgaccatcctgactgccag
gatattgtggtcgatgtggatggaaactaccgagaaatgcgacactttaccccatggcag
agaccccgggaagttgaagactactacctcgagcaaattgtcggcaagataacaggacag
tataaggttccctttggcgatgcggtcattagcacgagagatacatgcttgggactggag
acatgtgaggaactgttcacaccgaatggcccccatattccctacagtcttgcaggcgtt
gagatcatttcgaactcatccggcagtcaccatgagctgaagaagcttgatacgcgcgtc
aacctcatcacacaagccacaaaactgagcggtggtatctacctgtatgcaaaccagcaa
ggttgtgatggtgacaggctctactacgatggatgtgctatgattgtcataaatgggaat
atcgtagctcaaggatcgcagttctcactaaacgatgtggaggttgtcactgcaaccgtg
gacattgaagaagtgcgcacataccgtgcctcaacaagcagaaatatgcaagccagcaga
cagcccccttttgtccgtcttgaccttgacacgcgattgtctcgttcggacgaagacgct
gaccctggcattgcgccgtctgagacgctcataccccgctaccacgcgccagaagaggag
attgcccttggacctgcttgctggctgtgggattaccttcggagaagtggtgccgctgga
tttttccttcctctgagtggtgggattgacagttgcgctactgcagtaattgtccactct
atgtgcagggaggttatcaaagcagtacaacaaggaaatgagcaagtgatcaaagatgtc
cgcaggctctgcgcagagcctgctggctcaacctggctccccacaacaagccaagaagtc
tgcaacttcatgggcacgcagaactctagtaaagagacaagagaccgagcaaaggagctg
gctgcggagatagggtcgtaccatatcgacttcaacttcgacaccgttgtgaccgctttg
atgaatctatttaccgtcgtcacaaactttcagccaagatttaaggtccacggtggtagc
cgcgcggaaaaccaggcgctgcagaacattcaagctcgtctgagaatggtcctctcttac
ttattcgcgtcgttactgcccacagttcgccagcgcccaggcggcggtggccttctcgtt
ctggcgtcgtccaatgtagatgaatgtttacgaggctacctgactaaatacgacgcgagc
agcgccgatctaaaccccatcggttccatttctaaagtcgacctcaagaaattcattggc
cattgcgcaacctccttcgacatgcctatcctaacctcattcctcaatgccacgcccaca
gccgagctcgagcccatcacagcaacgtacgtgcagtccgacgaagcagacatgggcgtg
acctacgccgaacttggcacgttcggttacctgcgcaaagtgtccaagttgggcccttgg
agcatgtacgagcgcctgctgcacatgtggggtaatgagtattctccccgagagatctat
gagaaaacacgacacttcttctataattatgcgattaaccgtcataagatgactgttatc
acgccaagttatcatgctgagcagtatagccctgatgacaataggcacgatttaaggcag
ttcctttatcctcctttcacttgggcatacaagaaaatggaagaaagcgtcaagtactgg
gaagaaaggggctggacgacaggaaaagcgcagaaaaagagcgtcaaggcggattag

DBGET integrated database retrieval system