KEGG   Aspergillus nidulans: AN8255.2
Entry
AN8255.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K15322  tRNA-splicing endonuclease subunit Sen2 [EC:4.6.1.16]
Organism
ani  Aspergillus nidulans
Brite
KEGG Orthology (KO) [BR:ani00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ani03016]
    AN8255.2
Enzymes [BR:ani01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.16  tRNA-intron lyase
     AN8255.2
Transfer RNA biogenesis [BR:ani03016]
 Eukaryotic type
  tRNA spricing factors
   tRNA splicing endonuclease complex
    AN8255.2
Motif
Pfam: Rad9_Rad53_bind Tudor_3 tRNA_int_endo BRCT_2 BRCT tRNA_int_endo_N RTT107_BRCT_5 BRCT_3 Choline_sulf_C
Other DBs
NCBI-GeneID: 2869026
NCBI-ProteinID: XP_681524
UniProt: A0A1U8QHY5 Q5ATX5
Position
II
AA seq 1851 aa
MTSQPSNIAPSAPDQAVPAKPRPPRRQRPDYRHIHRFPLPLPVHPLPPLILHNPLSVISV
LLSYLTYFIAPPHDHVHSAYFDLNTSSVHVTDEKTVRALWEMGFFGKGSLSRSEPTWLEQ
EKTRRGLLGGVTSEEVTRQRRAERRELKLQRARSEKLIIEQRLQAEAAAREGRTLLDAQA
DLLSVSGVTNGAAITTEKFSVKKARESKFLEARQLAERDREAASKNVRFATVEGDTADRT
VINLRDPSGELAITNEEHLQLSNEEAFFLVYGLGALHIFDHDLKTVLSPTSLLRTLCHHS
YSPPRDLSMDLKTDDPFLVSYVVYHHFRSLGWVVRSGVKFGVDYLLYYRGPVFSHAEFAV
VVIPSYDHPYWSETKDRKAECARKQSRSWWWFHCVNRVQAQVKKTLVVCYVEVPPPTQML
DAASSSIDIGALLSRYSDDSWSIDIAKLQRDALGLQLFKYPDAIGNCSSPVSHDSITVPI
PNDHIVTSAPPKVTGESPVHGGSIGLDTNHNVTEPLDTNQPSPERATQPSSTGQAAAKMG
SAETIPSDTQVISQSVYDEIIRKNKEAGNEEPDSNLLDRNTLMTLQEGGSGNLDLLSGFD
AAQLQAPNTDENDDQNSSKLGESSPLSYERNNFPESQRFLAKTPLATKQGQLETDSTASP
LVSRNPLASDLESASGVMALSQVFKATQAPSSPLVNGLQSDLLSDRPSPNIPIQNRPLAP
SFSSPLNNIAATFPRDSSDTQLNYVTLRESQTSRNDMARGRMTRSADHIYSDGCSDGGFG
KEPLYTERRKREGRTDEENAAQFSMVSASARPPSDIEARKRRRATSLSRKTKRCDMEGNS
TAAVQLEQEGISYDLQAVGTSEEETEQEEELPRPTPQSQVPHPSTEEDKENCDDPPAIIP
HTGSAHDRLSQALSLHEGLTGTHRMPAQTVSGGHTPVRNDDLNPGTVDVVRSSPISVVKD
SQWSPERDDVKPADRTIVGSPSDQGQTRFRGPQWQSVAAAGHGRGILSPADQPFAQELQI
CSQNAPSAILRPEIADIARISNPSLEGSGGANANMHRLRKATNEPENGNMALIFGAREKS
SSMPSCVAETPVHRRQRASNDLPHFATIPETSPTRLDNGAWMSDGDNDAANQEDDDLPLP
YPKAMEDAHKPHQFMSQSSSPVKRLLNSKILSSPSGRQRRALTEIAADASPQVGATIDVN
IDIMSVEDYEFRDAIAQSPIRPRKKRRSNDGRNIPASDPIIPVTPRAESHFTPPREDDEM
VLALPSQPANPTNQRQSTSLRRPKPSRRAGSIWDTEDSPKFRLSSKERSKLFARSQARER
QPPPAPKPELQEAPQPTPVPSRAHVEITSTPIHEAPSSNLAIEESTGYIGQRPPPDNSIL
VPNQVLAPWRGQKRAYYPAVCLGTPFGTSQDQYMVKFEDSAPVEVPKGAVKRLELRIGDA
VKVDMPHIPKITHIIRGFAHKLSAEDAVNAVTDIYGHATLVVGPKQRKSLTNSGLVGPEN
VINVPVSRIYLDTILWNKIRDRPYTYTSGSEGLMSRLQTPPDRRIAQTPPSTRLSRSLRP
SDGLFSGMVFAVSYGDKSEAKYRVTKMILENDGRILDDGFNELFELPSYAPIATPTGATA
SQPTELDSHLRLKPGVENAGFACLIADKHSRRPKYMQALALNIPCLSDRWVEDCVAKGQV
MDWEMYLLPAGESSYLNGATKSRILTPYPATRARLSKTISSRPNLLNGQSVLLITGRNGK
VDEERRKAYIFLTYALGASKIKRVPDIQSARAALQKQLQDGQETSWDWVYIDDDDKAAKV
LAAGSLPSKRRKNYRLTETISGDDLGLNSNVRVVGNEFVCQSLILGRLVNY
NT seq 5556 nt   +upstreamnt  +downstreamnt
atgacttcccaaccatctaatatcgctccctctgccccggatcaagctgttcctgcaaag
cctcggccaccgagacgccaaaggccagactataggcacattcaccgtttccctctccct
cttcctgttcaccctcttcctcctctaatcctgcacaacccactttctgttatcagtgta
ctactctcttacctcacctactttattgcccctcctcacgatcatgtccattctgcctat
ttcgacttaaatacgtcgtcggttcatgttaccgacgagaagaccgtccgagctttgtgg
gaaatgggtttctttggaaagggaagtctaagtagaagtgagccaacctggctggaacaa
gagaaaacgcggagaggactgctcggcggcgtcaccagtgaagaggttactcgccagcga
agggccgagcgacgtgaactgaaactacagcgagcaaggtcggaaaagctaatcatcgaa
caacgacttcaagcggaagctgctgcaagagaaggtcgtacacttctggacgctcaggcc
gatctgttatccgtttccggcgtcacgaatggcgctgccataactacagaaaagttttct
gtaaaaaaggcgagagaatccaagttcctcgaggcacggcaattggcagaacgagatagg
gaggctgctagcaaaaacgttcgatttgctaccgttgaaggggacaccgcagaccgcaca
gtcatcaatctgcgtgacccttctggggaactggccataacaaatgaagaacacctccaa
ctttccaacgaggaagcatttttcctcgtatacggattaggcgctttgcacatctttgac
catgacctcaagaccgtgctctcccctacttctttacttagaacgctttgtcaccattca
tattcgcctccccgggatctatcgatggacttgaaaaccgacgacccattccttgtctct
tacgttgtgtaccaccatttccgctctctaggatgggttgtacgctccggtgtaaaattc
ggagtggactatctcctatactaccgaggacccgttttctcgcatgccgagttcgctgtc
gtggtgattccatcgtatgaccatccatattggtctgaaacaaaagaccgcaaagcagag
tgcgctcgtaaacagtcacgcagctggtggtggtttcactgtgtcaatcgtgttcaggcc
caggtgaagaagacgcttgtggtctgttacgtggaagtcccaccaccaacccagatgctg
gatgccgcttcgtccagtatcgacattggagcattgttatctcgttactctgacgacagc
tggagcattgatatcgcaaagctgcaacgcgacgcgctgggtttacaactcttcaagtat
cctgacgcaattgggaactgtagttcaccagtttctcatgattcaataactgtgccgatc
ccgaacgatcacattgtgacttccgctcctccaaaagtgaccggcgagtcccccgtgcat
ggaggctccatagggctggatacaaaccataatgttacagagccgctagacacgaatcaa
ccgtctcctgaaagagcaacacagccctcttctacggggcaagctgctgcaaaaatgggt
tctgccgagaccataccttcagacacccaggtcatatcccagtcggtatacgacgaaatc
atccggaagaacaaagaggctggaaacgaggaacctgacagcaatcttcttgaccgaaat
acgctcatgactttgcaagaaggcggtagtggcaatttagacctgctttctggcttcgac
gctgctcaattacaagcaccgaatactgacgagaatgacgatcaaaacagctccaagtta
ggagagtcctcgcctctctcatatgagcgcaataattttcccgagtctcaacggttcctt
gcgaagacccctttggcgacgaagcagggtcaacttgagactgattctacggcttctcct
ttagtctctcgaaacccattagcatctgacctcgagtcagcaagcggggtaatggcattg
agtcaagtatttaaggccacgcaggcgccttcgtctccccttgtaaatggcttacaatcg
gatctcttgtctgatcggccgtcgcccaatatcccgatacaaaaccgcccgcttgcgccg
tcattttcctccccattaaacaatatcgcggcaacgtttcctcgtgactcgtcggacacg
cagctcaactatgtcacgctgagagaatcacagacaagtagaaatgacatggctagggga
agaatgacgcgttccgcagaccatatatattctgatggctgcagcgacggtggattcggc
aaggagcctctttacactgagcgcaggaaacgtgaagggaggactgatgaggagaatgcc
gcacaattttcgatggtctcggcttctgcaaggcctcctagcgatatcgaagcacggaaa
agaagacgagccacctcattatcgcggaaaacgaaacggtgcgatatggagggaaactct
actgcggcagttcagctggagcaggaagggattagttatgacctacaggctgtagggacg
agtgaagaagagacagaacaggaagaggagttaccaaggcctacgccgcaatctcaggtt
ccccatccctcaacagaagaggacaaggaaaattgcgatgatccaccggctatcatacca
cacactgggagcgctcatgaccggctttctcaagctctttccttgcatgaaggtttgacc
ggcactcatagaatgcctgctcagacagtctcaggcggacacacacctgtacgaaacgat
gacctgaatcccggtacagttgacgtggttagatcttcaccaatctccgtggtgaaagat
tcacagtggtctcctgagcgtgatgatgtaaaaccagccgaccggacaattgtgggaagc
cctagtgatcaaggccaaacccgctttcgcggccctcagtggcaaagcgtggcagcggcg
ggacacgggcgtggtatattatcacctgctgatcagccttttgcccaagaacttcagatc
tgtagtcagaatgccccttctgccattcttcgcccagaaatcgccgatatagcgaggata
tcaaatccatctctggaggggtctgggggtgcaaatgcaaatatgcatcgcttgaggaaa
gcaacaaacgaacccgagaatgggaacatggcgctgattttcggcgcccgagaaaaatct
tcttcaatgccgtcgtgtgtcgcggaaacccctgttcatcgccgacaaagagcatctaac
gatctaccacattttgccactattccagagactagcccaacccgtttggataacggggcc
tggatgagtgatggggacaacgacgctgcaaatcaggaggatgatgatttgcctcttcca
tatccaaaggcaatggaagatgcccataagccacatcaatttatgtctcaaagctcatct
ccagttaaacgtttgctcaattcaaagatcctatcaagcccaagcggaaggcagcggagg
gctctgacggaaatagcggccgatgcttctcctcaagttggggctactattgatgtcaat
atcgacatcatgtctgttgaagactatgaatttagggatgctattgcacagtctcccatt
cgtccacgaaagaagcggcgtagcaatgatggtcggaatatcccagcgtcggatccaatc
attcctgttacgccccgcgcagaatctcacttcactcctccacgggaggatgatgagatg
gtattggctttgccctcgcaacccgcaaaccccacgaaccagcgtcaaagcacatcctta
cggcggccgaaaccttcaagaagggccgggtctatctgggacacggaagattctcctaaa
ttccggttatcaagtaaagaaaggtctaaactgtttgcccgctcacaagctcgagagcgt
cagcctccaccggcgccgaagccagagctacaagaggcacctcaacccacgcctgttcca
tctcgagcccatgtggaaattacctcgactccaattcatgaagcaccaagtagtaacctg
gctattgaggagagcacgggctatataggccagcgacctccccctgataattctatattg
gtaccaaaccaggttcttgcaccttggaggggccaaaagagggcctattatccagcagtt
tgcttaggaacgccttttgggacatcacaggatcagtacatggtcaagttcgaagacagt
gccccagttgaagtgccaaaaggtgctgtcaagaggcttgagttgcgaatcggcgatgct
gttaaagttgatatgccacatattcccaagattacgcacattatcagagggtttgcgcat
aagctcagcgcagaagatgccgttaacgcagtcacagacatatatgggcatgcgacgctt
gttgtagggccaaaacaacgcaagagccttacgaacagtgggctagtaggccctgagaat
gttattaatgttcctgtctcacgaatttacttggatactatactgtggaacaaaataagg
gatcggccttatacttacacttccggctctgaaggcttaatgagcagactacaaactcct
ccagacagacgcatcgcacaaactccacctagcacaaggctatctcgcagcctccgtccc
tcagatggcctattttccggcatggtatttgccgtgtcctatggtgataagagcgaggcc
aaatatcgcgttacaaagatgatcctggaaaatgatggacggattttagatgatggcttc
aacgaattatttgagcttccatcatatgccccaattgcaacgccgacgggagcaacagct
tcccagccaacagaactggattctcatcttcgtcttaaacctggtgttgaaaatgctggc
tttgcgtgtctaatcgcagacaaacactcccgtcgtccgaaatacatgcaggcactggct
ctcaatattccttgtctctcagaccgttgggtagaggattgcgttgctaaaggccaggta
atggattgggaaatgtaccttctccctgctggtgaatcatcatacctcaatggggcaacg
aagtcgagaatcctcacgccctacccggcgactagagcacgactctccaagactatctca
tcgcggccaaatcttctaaacgggcaatctgtcttgcttattacaggccgcaacgggaag
gtagacgaggaacgaagaaaagcctacatcttcctaacatatgctctgggtgcatcgaaa
atcaaacgtgttcctgatatacaatctgcccgggcagccctccagaagcagctacaggac
gggcaggaaacatcttgggactgggtctatattgatgacgacgacaaagcagccaaggtt
ttggcggctggatccctgccatcaaaaagacggaaaaattataggctcacagaaacaatc
agtggagatgacctgggcctaaatagcaatgtccgggttgtgggcaacgagtttgtctgt
cagagtttgattcttggacggctggtaaattattga

DBGET integrated database retrieval system