KEGG   Aspergillus nidulans: AN8590.2
Entry
AN8590.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
Organism
ani  Aspergillus nidulans
SSDB
Motif
Pfam: Fungal_trans Zn_clus
Other DBs
NCBI-GeneID: 2868351
NCBI-ProteinID: XP_681859
UniProt: A0A1U8QGF0 Q5ASZ0
Position
III
AA seq 953 aa
MAWVGQGRMGRLNAHDDWVRQHRIEKLASRNLTSLLVVRVDPEQRPGATRRYGKRGPGDI
SRANQSRLADRVRECKAQHGRRCHQSGLSPGRETASFGRPFFTCAPRSTACRPPSTLLLL
ERWITLSSTGTTVSCSSILPASSFPRVRRVMRSNKRPRPAGNNAVFRLVSFPDPSPPAMS
EQRAEPSAAPAPPAAPSARTATDPVLPLTPSEPSTPGSKIPIPRVSQLRAYGNRRVKRAC
IECRKQKTKCNGQTPCSRCIGLGMDCVYMDGKREVTEKRLHDLERQVQAYDRLLQEIQPR
VDSQDRDLILRTRAQDPAHVDPTPHGSTHTPSFGIEYIQEDFHKDKGLQAIGFMGGPSEM
SWINELYQVLEKDTPFLDSEASNKSQSLTSVCYFLDDEELSLEPNIDPYGRPPRHIADQL
LDCYFFTVHPSFPIIAKMPFMQQYEMYYTRTDIQPTKRWLTILNLVFALASKFAQLVSKP
WIAEADSPMACFTRARKLNYSESQLLEHPNLQQVQVEGLTAFFLMAIGHINRSWRACGVS
VRSAIALGVNLRSESKETSTLSKEIRYRVWWSIYTLENTLSIMTGRPTSAPDKYSTTPLP
IPFDEEQFREPLASRLLTDFRMRTDYMLALTSQRRGSLSVWDPPRLGHTGFGQEPRPGPT
EISPSNSFYFFYFVELTVIMRRAIDSLYSPGFARRPWLTISASIMDLVQETDEWLSRVPA
VFQWRGSHPSPHFERQRWSLAFRFYSLRIALSRPSLCRSERQRSPNEASALSQQRIARIC
INSACELLDMLPDKPDALWLVQVSPWWCVLHYLMQSITVLLIEMEFCVRFHADGASHITL
HLEKGLDWLLSLGTISVPSRRAWEVCNSIYNRLFFGPGPRASMLSDLRVFSPEQESRSST
MTSPTAMSPAYEATEFNEGKAFGEPFPKLPHNMTVHPSIQTPYDDISLYKNTS
NT seq 2862 nt   +upstreamnt  +downstreamnt
atggcctgggtcggccaggggcgaatgggcaggctgaatgcgcacgacgattgggttcgt
cagcacaggatcgagaagctcgcttccaggaacctgacgagcctgctcgtcgtgcgggtg
gatcccgagcaaaggccgggggcgactaggagatatggcaagagaggaccaggggacatt
agccgggccaaccagagccgcttagctgatcgcgtgagggagtgcaaggcccagcacgga
aggcggtgccaccaatcgggacttagtcccggccgggagaccgccagctttggtcgccca
tttttcacctgtgctcctcggtcaacggcttgtcgacctccatcaacgcttctgctgcta
gagagatggatcactctttcctcaaccgggacgaccgtctcctgctcttctattcttccc
gcttcgtcgttcccccgcgttcgtcgtgtcatgcgatcgaataagcgccctcgccccgcc
ggcaacaatgcggtcttccgtctcgtctcgttccccgacccttcacccccagccatgtct
gagcagcgagcagagccgtcagcggcgccagcgccgccggcggctccgtctgcgaggacg
gccaccgacccggtgctgcccttgaccccgtcggagccgtcgactcccggctccaagatc
ccgatcccccgcgtttcccagcttcgagcgtacggcaatcgacgggtcaagagggcctgt
atcgagtgtcgcaagcaaaagacgaaatgtaacgggcagaccccgtgcagccgctgtatc
ggtcttggcatggactgcgtttacatggacgggaaacgggaagtgacggaaaaacggctc
catgatctggaaaggcaggtgcaggcttacgaccgactgctgcaggaaatccagccgcgc
gttgatagccaggaccgggatctgattttgagaacccgagctcaggatccagcacatgtc
gacccgacgccacacggctcgacacataccccgtcgtttggtatcgagtatatccaggag
gatttccacaaggacaaggggttacaagcgattgggttcatgggcgggccctcggagatg
tcgtggattaacgagctgtaccaggttctggagaaggacaccccttttttagactcggag
gcgtcgaacaaatcgcagtctctcacatcggtctgctacttccttgacgacgaagagctc
tccttggagcccaatattgacccgtacggccggccgccgcgtcacatcgccgaccagctg
ctcgactgctatttcttcaccgtccatccatcctttccgatcatcgcaaaaatgccgttt
atgcagcagtatgagatgtattatacgcggacagatatccagccgacgaaacggtggctg
accatcctgaatctggtctttgcgctggcgtccaagtttgcgcaactcgtctcgaagccg
tggattgcagaagcggactcgccgatggcctgtttcacccgagcgcggaagctgaactat
tcggagagccagctgctggaacatcctaatctgcaacaggtccaagttgaagggttgacc
gcgttctttttaatggccatcggacatatcaaccgctcctggagagcttgtggcgtttcc
gtccgctcagccattgcccttggggtcaatctgcgcagcgagagtaaagaaacgtccacg
ctctcaaaggagatcaggtaccgggtgtggtggtcgatttacacgcttgagaacacacta
tcgatcatgactgggcgaccgacgagtgcaccggacaagtacagcacgacgccgctgccg
attccctttgatgaggagcagtttcgagaaccgctagcgtcgcgactgctaacggacttt
cgtatgcgcaccgattatatgcttgcactgacgtcccagcggcgggggagtctcagcgtc
tgggatcctccgagattgggtcataccgggtttgggcaggaaccacggccgggtccgacg
gaaatctccccaagcaattccttttatttcttctacttcgtagaactcaccgtcatcatg
cggcgggccatcgactcgctctacagccctgggtttgcacgccggccgtggctaaccatc
agcgcctccatcatggatttggtccaggagaccgacgagtggctgagccgggtccctgcc
gtgttccagtggaggggcagccatccctcgcctcacttcgaacgtcagcggtggagtttg
gcctttcggttctacagtctacgcattgccctcagtcgaccctcgctgtgtcgctcagag
cggcagcggtcccccaacgaagcgtcggcgctcagtcagcaacggatagcgcggatatgc
atcaactctgcatgcgagctgctggatatgctgccggacaagccagatgcgctctggctc
gtccaagtgtcgccctggtggtgcgtgctgcactatcttatgcagtcgatcaccgtgctt
ctaatagaaatggaattttgcgttcggtttcatgccgacggagcatctcatatcaccttg
catctggagaagggtctggactggcttcttagcctgggtacaatcagcgttccttctagg
cgagcctgggaagtttgcaacagcatctacaatcgtctcttcttcggaccgggcccccga
gcgtccatgctgtcggacctgcgcgttttctcgcctgaacaggagtcgcgtagctccacg
atgacttctccaaccgccatgtctccagcctatgaagcgacagaattcaacgaaggaaag
gcatttggcgaaccgttcccgaaacttccgcataacatgacggtccatccttccatccag
acgccctacgatgacatctcgctctacaagaacacaagttaa

DBGET integrated database retrieval system