KEGG   Aspergillus nidulans: AN8827.2Help
Entry
AN8827.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K07359  calcium/calmodulin-dependent protein kinase kinase 2 [EC:2.7.11.17]
Organism
ani  Aspergillus nidulans
Brite
KEGG Orthology (KO) [BR:ani00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ani01001]
    AN8827.2
Enzymes [BR:ani01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     AN8827.2
Protein kinases [BR:ani01001]
 Serine/threonine kinases: Other
  CAMKK family
   AN8827.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Pkinase_fungal MuF_C
Motif
Other DBs
NCBI-GeneID: 2868337
NCBI-ProteinID: XP_682096
UniProt: Q5ASA3
Position
III
AA seq 507 aa AA seqDB search
MANEGAGSLQQDASPGSSARPEPYPRPRCLLGILHFSSTPSFESPQRHHRRNPIARRPVK
ETLNARSEYTLSQDDGTAEHRINQYVIKQEIGRGSFGAVHVAVDQYGNEYAVKEFSKARL
RKRAKSQLLRQSRGPKRPADGLNSPFHRQGPGLGDEEMKNALYFIKEEIAIMKKLHHNNL
VSLIEVLDDPTQDSLYMVMEMCKKGVVMKVTLEERADPYDDERCRCWFRDLILGIEYLHA
QGIVHRDIKPDNCLITNDDVLKVVDFGVSEMFEKNSDMFTAKSAGSPSFLPPELCVVKHG
DVSGKAADIWSMGVTLYCLRYGKLPFEEHSIIELYDAIKNRPIVCDGETDEVFKDLMLRI
LEKDPAKRIQMDELREHPWVTKNGMDPLLPKSENTAEIVDLPTEEEMNSAITKNFGHVLA
VMKAAKKFKSLLGPTRASTPIQSILGQEYETHFVEPPTQMDPEESVSLPSPLPYKKTQSL
NTYNRRAWERDDVTNKERFRLNTKCQN
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggccaacgagggtgctggctctctgcaacaggatgccagtccaggttcttctgctcgg
ccagagccttatcctcgcccaagatgcttactcggcatcctgcatttcagctccacacct
tcgtttgagagccctcagagacatcatcgccgtaatccaatagcccggcgtcctgtgaag
gaaactctcaatgctcggtcagaatatactctcagccaagatgatggcactgcggagcat
agaatcaaccaatatgtgattaagcaggagattggccgcggctcgtttggtgcggtgcat
gttgctgttgaccagtatggaaatgaatatgctgtcaaagagttttccaaggcgcgtcta
agaaaacgcgcaaaatcgcaacttctgagacagtctcgaggtccaaaacgtccagcagat
ggcctaaactccccttttcatcgccagggaccgggacttggagacgaagagatgaaaaat
gctctctattttatcaaagaagaaattgccattatgaagaagttacaccacaacaatcta
gtatccttgatagaggtactggacgacccgacccaagattctctatatatggtcatggag
atgtgcaagaagggcgtggtcatgaaggtcactctcgaagagagggcggatccctacgat
gacgagcgttgtcgctgctggtttcgtgacctcattttgggcattgagtatttacatgcc
cagggtatcgtccaccgtgatatcaagcccgacaactgcctgataacgaacgatgatgtt
ctcaaagttgtcgattttggcgtatcagaaatgttcgaaaagaattcggacatgtttacg
gccaaatctgctggatctccttcctttctgccaccggaactctgcgttgttaagcacggc
gatgtatctggaaaggcggcggatatatggtccatgggcgtgaccttgtattgtttgcgc
tacggcaagcttcctttcgaggagcacagcattatcgaactctacgatgccataaaaaac
cgcccgattgtttgcgacggcgaaactgacgaagtttttaaagatttgatgttgcgaatt
ttggaaaaagaccctgcgaaaagaatacagatggacgagctgagggagcatccctgggtg
acgaagaatggcatggatcctttactgccaaagagtgagaatacggcagaaatagtcgac
cttcctacagaagaggaaatgaactccgcaatcacaaaaaattttggccatgtcttagcc
gtgatgaaagctgcgaagaaatttaaaagccttcttggcccgactcgagcttctacaccc
atacaaagtatcctcggccaagaatacgagacgcactttgtggaacctcctacgcaaatg
gatcctgaggagagcgtatccttgcctagtcctttaccatacaaaaaaacccaaagtttg
aacacttataaccggagagcttgggagcgtgacgatgttaccaacaaggaaagattccgg
ctcaatacgaagtgtcaaaattag

DBGET integrated database retrieval system