KEGG   Aspergillus nidulans: AN8935.2Help
Entry
AN8935.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K17100  dihydroxyacetone synthase [EC:2.2.1.3]
Organism
ani  Aspergillus nidulans
Pathway
ani00680  Methane metabolism
ani01100  Metabolic pathways
ani01200  Carbon metabolism
Module
ani_M00344  Formaldehyde assimilation, xylulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:ani00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    AN8935.2
Enzymes [BR:ani01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.3  formaldehyde transketolase
     AN8935.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transketolase_N Transket_pyr E1_dh Transketolase_C DXP_synthase_N
Motif
Other DBs
NCBI-GeneID: 2868146
NCBI-ProteinID: XP_682204
UniProt: A0A1U8QLZ2 Q5ARZ5
Position
VII
AA seq 719 aa AA seqDB search
MAPGLELLPKTTALPTKAANAINNAVYGRDSDVKFESAEKHQRVLNVFRAFIADLVQQYG
DGHPGAPMGMAAIGIALWKYVMKYSPTNCNYFNRDRFVLSNGHACLWQYLFMHLVGVKSM
TLEQLKSYHSTDSSSLCPGHPEIENEGVEVTTGPLGQGVANAVGLAMATKNLAATYNKPG
YEVVNNMTWCMVGDACLQEGVGLEALSLAGHWRLNNLCVIFDNNNVTCDGTADVANTEDI
NTKMRATGFKVIDVYDGDSDVVAITNALLAARSSTKPTFINIRTTIGVGSKQAGTADAHG
AALGVDEVAKIKRAFGLNPEEHFHIPQDVYDFFSDLPSRGKTHEAEWHAAVAAYREAEPV
LASEFDLRVAGKMPADWTKYKLGQNVKNFLVGTADLTPSVNVAYKNKVDFQSPDLKTACG
MSGNYAGRYIHYGIREHAMCAISNGLAAFNKGTFIPITSTYLVFHLYAAAAVRMAALQGL
HQIHIATHDSIGVGENGPTHQPIAVPALYRAMPNILFIRPCDAEETVGAYIAAIQHDTTP
SVLALSRQNLTQYPAHSSREGVQKGAYVFVEEENFDVTLLSVGSEMAYTMAAREILAAEH
GIKARVVSFPCARLFELQSREYKHSVLKPRAGKPAVAIEAYPSVGWERYADAAIAQNQFG
KSLPCKEVYEHFGFSGKIIADKVKGLVDEVRRDGVEVLRGDFRDLNGGPSVGVEHPNVP
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atggctcctggattagaactgctccctaagaccacggccttgccgacaaaggctgccaat
gccatcaacaatgccgtctatggcagagactctgatgtgaagtttgagagtgccgagaag
caccagcgggtgttaaatgtcttcagagctttcattgccgacctggttcagcaatatggt
gacggacaccctggagcgcccatgggcatggcggccatcgggattgcgctgtggaaatac
gtcatgaaatactcgcccacgaattgcaactacttcaaccgcgatcgctttgttctttcg
aatggtcacgcctgtctctggcagtacctcttcatgcaccttgtcggcgtcaagagcatg
acccttgagcagttgaaatcctaccactccacagactccagttccctatgccccggccat
ccagagatcgagaacgaaggtgttgaggtaacgaccggcccactgggtcagggtgtcgcg
aacgcagttggactcgccatggcgaccaagaacctcgccgcaacgtacaacaagcctggc
tatgaagtcgtgaacaacatgacctggtgtatggttggcgacgcttgtttgcaggagggc
gtcggtcttgaagctctgtctctggctgggcactggcggctcaacaacctttgtgtgatc
tttgacaacaataatgtaacctgcgatggaacggcagatgttgccaatacggaagacatc
aacaccaagatgcgcgcgacaggcttcaaggtgattgacgtgtatgacggggattcggac
gttgttgccatcaccaatgcgctcctcgctgctcgctcctccaccaagccaactttcatc
aacattcgcaccaccatcggcgtaggctccaagcaagccggcacggccgatgcgcacggc
gccgccctgggcgtcgacgaagtcgccaaaatcaagcgcgcctttggcctgaaccctgag
gaacacttccacatcccccaagacgtttacgacttcttcagcgatctaccatcgcgcggg
aagacccatgaggcagaatggcacgcggctgttgccgcataccgcgaagctgagcccgtg
ctcgcctctgaatttgacctccgtgtcgcaggaaaaatgccagcagactggacaaagtac
aagctcggccaaaacgtcaagaacttcctcgtcggcacagcggatcttaccccctccgtc
aacgtggcctacaagaacaaagtcgacttccagtcccccgacctcaagaccgcgtgcggt
atgagtggaaattatgcaggccggtatatccactacgggatccgcgagcacgccatgtgc
gcgatctccaacggtctggcggcgttcaacaagggcaccttcatcccgatcacaagcacc
tacctcgttttccacctgtacgctgccgccgctgtacgcatggccgctctacaggggctg
caccagatccacatcgccactcacgacagcattggcgttggagagaatggaccaacgcat
cagcccatcgccgtaccggcactctaccgtgcaatgccaaacatccttttcattcggccc
tgtgatgcagaggagacggttggggcgtacatcgcagcaatccagcacgacacaactccc
tccgttctggcactgtcgcgccagaaccttacgcagtaccctgctcactcctctcgagaa
ggcgtgcagaagggagcctacgtcttcgtcgaggaagagaactttgacgtcactctcctc
agcgtgggctctgaaatggcttataccatggcagcgcgcgagatccttgcggccgagcac
ggtatcaaagcgcgtgtcgtttcattcccttgcgcacggctcttcgagcttcagtcccgc
gagtacaagcactccgtcttgaaaccacgcgcgggcaaacccgctgtcgcgatcgaggcg
tacccttctgttggctgggagcggtatgctgatgcggcaattgcgcagaaccagtttggg
aagagtctgccgtgtaaggaggtgtatgagcactttggatttagtggaaaaatcattgca
gataaggtgaaaggattagtggatgaggtgagacgcgatggtgttgaggtgttaagaggt
gactttcgggatctgaatgggggtcctagtgtcggtgtggagcatccaaatgtgccttag

DBGET integrated database retrieval system