KEGG   Aspergillus nidulans: AN9226.2
Entry
AN9226.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K23627  cyclopeptine synthase [EC:6.3.2.40]
Organism
ani  Aspergillus nidulans
Brite
KEGG Orthology (KO) [BR:ani00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AN9226.2
Enzymes [BR:ani01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.40  cyclopeptine synthase
     AN9226.2
SSDB
Motif
Pfam: AMP-binding Condensation PP-binding AMP-binding_C Methyltransf_11 Methyltransf_25 Methyltransf_12 Methyltransf_23 DUF2527 Methyltransf_31
Other DBs
NCBI-GeneID: 2868069
NCBI-ProteinID: XP_682495
UniProt: Q5AR54
Position
IV
AA seq 2559 aa
MAVSYTNFTNLPAKLYLVYRACTFTPLHAENLASNITQAMKQLLAQPDACVKDIDIFSPF
NEITVSRWNAEIQEAPDASLLEVIRGHSRYRPSHTAIHAWDGTVSYSELDVTSTKWAIYL
QSQGVKAGCLVPIMMDHSKWAVIGQLAILKAGGAFVPLDPGQPLFRLENIVRLTTESHIS
LSSPHLANRLHGLVETVLVISDERTESLPKANAHHDAADISPVVNNGPAYVLFTSGSTGR
PKGCVVGYGALSDVVNQTTALKIGPDSRVLQFASYTYGMSLIEIYCTLAAGATICVPSED
DRLNALSSILLSMQVTWAILTPSTTISIADAVVCLNTLVVAGEALTMDRLHSLADKTEVI
QAFGLTEWAGICCVSQRITSETDLRVIGRSHTARLRLVDPANYNRLAPVGAVAELLIEGP
AMADGYLGDPEQTARAFPKTSTGGRFYRTGDLVQYAADGSLRYVSRKDSQVKIRGMRVEL
TEVEYQIRRAFPGVEEVVVEAAAPKNSSGIPILVAFLCPEDLSGLVCTIKETMKRSLPDY
MRPSVYVPLEFIPKTISRKVDRKALRHLVQSSTRHELERYTQASLPSLVGPRTNIEQLVH
ELVADMLRLDPLSLGMRQNFISLGGDSVTAMLLVNKLRRKGYKITVAAILRAQSLLDVAS
LVHYPAGLEPSAQKSTPGDLKLVPRAIHRISDSGTVEQSFSQARIWFLQTLRPSSTWLLL
PSATRLRGSLRVDALETAFSALVERHETLRTTFEDREGSGVQVVAPFHPYQLEIIEIPSG
SDADLITALHGQQIRPMDLTKECWRATLFRLSPDEHVLNIVLHHIICDGWSFDIFLKTLQ
IYYAAALQGHSPLEGVEPLPIQYRDFSIWQRQNKARTSVEQLAYWVRQLDGSQPAEFLCD
KKRPHMLSGKAGSQPVKIDVCLYHDVKRFCSMKHVTPFTVLFAAFRATHYRLTGASDATI
GIPSVSRPQAELEELIGYFGNVQCIRTKVESCSSSFQLLVHQVQSSITAAFENQDVPFDQ
IVSKLLKDRDVSRHPLVQVAFILHTQAQFGKLRLEGLESEQLPLPHVSRLDLEFHLYPGE
GGGDLQGEVLYSMDLFHAETINAMVLVFYDILREGIRKPDTSIDSLPFPGGYSILNERGL
IYPQQSRSLSIIDLFDEQVRAQTDEVAVKDINGHLTYSELHKRSSMLSAWLKNSYSFAEE
TPVGVYASRSCESIVAILGILRAGLAYIRLDIDAPKARTEMILSCLPNCRLVLVASGLEP
PRVCVQGVQFAYIADSCKETVTDVHDFLKTCTPPGPMSLAYIVFTSGTTGTPKGVMIEHH
GVANLAKEPDIIAHAVNSRIASHMLNPSFDASGFEIYATLLNGGTLVCIDNSVVFDFPAL
GATFIQHGIRRAFMTPAILKQTLASCNSLLRMLDILYVGGDKLDPGDVAKVQRLTTGRVQ
IFNCYGPTENSIVSTKYRVPVDEEGVNGVPIGRSISNIGAYVVDRSLRLLPLGVLGELVV
TGPALARGYIDPKHDIGRFIELDISEEVAPMRAYRTGDMVRYRPRDAQLEFFGRMDQQVK
VRGYRVELAEIDNTLLLSPFISAAVTVARQDQELVSFVTVSDMASGFNDRAETEHVDSWL
DVVEGEDYYGSVGTIEPHSLGADFLGWISMYDGEPIDKNDMREWLQDTITAILSCSPSSV
LEIGTGSGMILFNIIGSIQKYVGLEPSPRAVDFVRRAVHWVPEAAGKVNIKCGTASDIGR
LQDMGTLDLAVINSVAQYFPSLDYLRNTIKDLVRQGVKSIFLGDIRSYALYQEFQVSKVL
RLYGRGLTITRFRQHMAEIARLEKELLVDPAFFTSLPAELPGMIEHVEIWPKRMKATNEL
SCYRYTAVLHVKRAEQPLLIREVKEISWADFQAKGWDYNSLSQMLEISDASTVLAVENIP
FKKTIVERDMVRLLQELPEDTGSVSWSSNARGPKRALAPIDLFDVAKKTGWDIEISWARQ
RSQRGGLDAVFHRQGPRVLFRFPVDPYIPGACSNDPLSPQRNRLLEKHLLEYMSTKLPTY
MVPKLIHVLDKMPINNIGKVDRHVLAQRAAITSATISESESLFRREIEPAFTSEIERAVW
EEFTGVLGREVGVADSFFRNGGHSLMAIRLVSRINKRLSSALSVSELFRYPTVSGLAQHL
QGLGALETRAVTVYAPFSLLDRPYDPSEVRLPPEADIVDVTPVTECQAWFLQCWSLVSHS
FIIHGVLDVDRLRAACQAVVRHHPPLRTVFTEFQTQLVQAFDGVSLSAILYDIARAYGNS
ASPLSNAVPFSHHLHMCRSTRPDALAFWKAYLRDAVLTEVPRPEEVNATNEKPLEIIQQE
ALGEVSLPSTVDITFSTLVNAAIALALARLVQRNDVIFACVMTSRGVLAELAESVVGPCV
NRCLLRVKVPDDSNPDSTALDFCRNLRDNQAQVSGHGHLGFRDVVENCTSWASLGVDVGR
IAFVTHLPAETALETFSLTLLDSPVSYDSTNVTINPGNQILVRSAITDEQQACIQVLSSS
NVMGAEKALFLANRILMIAQRLSVSVSGGRSPRLLELDK
NT seq 7680 nt   +upstreamnt  +downstreamnt
atggctgtttcgtacactaactttacgaatctaccggcgaagctatacctggtctaccga
gcttgcactttcacccctttacacgctgaaaacttggcgtcgaatatcacgcaagcaatg
aagcaacttttggcacagcccgacgcatgcgttaaggacatcgatatcttcagtcctttc
aatgaaatcacagtttctcgttggaacgcagaaattcaggaagctccagatgcctctttg
ctcgaggtgatacgagggcattcaaggtaccgtcccagccacacggcgatccatgcctgg
gacgggacagtatcctactcggagctggacgtcacttcaacaaaatgggctatctacctg
caaagccaaggagtcaaagcgggatgtctggttcccatcatgatggatcactccaaatgg
gcggtgattggacagctcgctatattgaaagccggtggcgcctttgtgccgctagatcca
gggcaaccattgttcaggcttgagaatattgtgagacttactactgagtcacatatttct
ctctcatcgccgcatcttgccaatagactgcacggcctggttgagactgtgcttgtaatc
tctgatgagagaacagaatctcttcccaaggcaaatgcccatcatgatgccgctgatatc
agccccgtggtcaacaatggtccagcgtacgttcttttcacgtctggtagtaccggccgg
ccgaagggatgtgtggttggatatggagctctcagcgacgttgtcaatcaaactacggcg
ctcaaaatcggcccggacagccgagttttgcagttcgcctcatacacgtacggcatgtcc
ttgattgaaatatattgtacacttgctgctggggctaccatatgtgtgccttctgaggat
gaccgacttaacgctttaagcagcattctgctgtccatgcaagtgacctgggcaatcctt
accccatcaacgacaatatctatcgctgacgcggtagtatgtctgaatacactggtagtc
gctggagaagctttgaccatggaccgacttcactccctggcagataagacagaggtaatc
caggcctttggactgactgagtgggctggtatatgctgtgtgtcgcaacggattacctca
gagacggacctgcgcgtaattggccgttcacatacagcgcgcctacgcctcgtagatcca
gcaaattacaacagactggctcctgttggtgcagtggctgaactactcattgaagggccc
gcaatggcagatggatacttgggggaccctgagcagacggccagagcgtttccgaagacg
tcgaccggtggcaggttctataggaccggtgacttagtacagtacgcagcagacggaagc
ctccgctatgtttctcggaaagacagtcaggtcaagattcgggggatgcgggttgaactc
acagaggtggagtatcagatacgacgggcattccctggggttgaagaggtggttgtcgag
gcagctgccccgaagaattccagtgggattcctatcctcgtagcctttttgtgtcctgag
gatttatcaggtctggtttgcacgatcaaggagactatgaaacgaagtttgcctgactat
atgcgccccagtgtttacgttcctttggagttcatccccaagacgatctctcgaaaggtc
gaccggaaagctctgcggcatcttgtacagtcatctacacgccatgagttggagagatac
acccaagcctcactcccttcattggtaggcccacggaccaatatcgaacagctagtacat
gaactcgttgcagacatgttgcgtctcgatccgctctcactgggaatgcggcagaacttc
ataagtctaggtggtgattcggtaaccgcgatgctcctggtcaataaacttagaaggaaa
gggtataaaataaccgttgcggcaattctgcgagcgcaatcgcttttggacgtcgcttca
ctagtgcattacccagcaggccttgaaccctccgcgcagaaaagcacacccggagacttg
aagttggtaccgagggctatacacaggatttctgactccgggactgttgagcaatcgttc
tcacaggcgcgtatatggttcctgcaaaccctacgccccagctctacgtggcttctccta
ccatctgcaacacgtctgcggggatcgctccgggttgatgcattagaaacggctttctca
gcccttgtagaacgtcacgaaacattgcggacaacatttgaggatcgggaggggtctggg
gtgcaagtggtcgcgccttttcatccataccaattggagataattgaaataccatctggg
tcagatgctgacctcataacggcactgcacgggcagcaaatacggcccatggatctcacc
aaagagtgctggcgtgctacgctattccgtctctcacccgacgaacacgtcctcaatatt
gtcctacaccatatcatatgtgatggctggtccttcgatatctttctgaagacattgcag
atatattatgctgctgctctccaaggccattcaccattagagggggttgaacctctgccg
atccaataccgggacttctcgatatggcagcggcaaaacaaggcacgaaccagtgtggag
caactagcctactgggtgaggcagctggatggtagccagccggctgagttcctatgtgat
aagaaaaggccgcatatgctgtcgggtaaggcaggatcccagccagtgaagatagacgtt
tgtttgtaccatgatgtgaagcgcttttgttcaatgaagcatgtaacaccatttaccgtc
ctgttcgctgcgttcagagcgacacattatcgattgaccggcgccagtgatgcaacaatc
gggattccatctgtgtctcgtccccaggcagagctggaggaactgattgggtattttggc
aatgtccaatgtattcgtaccaaggtggaaagctgcagttcatcattccaactgcttgtg
catcaggtgcaatcatccatcactgcagcattcgagaaccaagatgtcccgtttgatcaa
attgtttccaaattattgaaggaccgcgatgtctctcgccatcccttagtccaggttgcc
tttatcctacacacgcaggcacagttcgggaaacttcgtctggagggcttggaaagtgaa
caacttcccctgccccatgtgtcaaggctcgatctcgagtttcacttgtatccaggcgaa
gggggaggagatcttcagggcgaggtcctctattcgatggacctgttccatgctgaaacc
atcaatgcaatggtcttggtgttttacgatattcttcgcgaggggattcgtaaaccggat
acgagcattgactcactgccatttccaggtggatattcaatattgaatgaacgggggttg
atctatcctcagcagtcccggtcgttgagtattatcgacttgttcgacgagcaggtccgc
gctcagacggacgaagtagctgtcaaagatataaacgggcatctaacctattcagaactg
cataagagatcctccatgctctcggcctggctaaagaacagctattccttcgccgaggaa
actcccgttggtgtgtacgccagccgaagctgtgagagcattgttgccatcctgggtata
ctgagggcaggcctcgcgtatatccggctagacattgatgctccaaaggctcgtacggag
atgattctttcatgtctgcccaattgccgccttgtcctagtagcatccggacttgaaccc
cccagagtctgcgtccagggcgtccaattcgcgtatatcgcagattcatgtaaagaaacc
gtcacggatgtccacgactttttgaaaacatgtactcctcctggaccaatgagcctcgca
tatatcgtgttcacatcaggcacgactggaacgccaaagggtgtcatgatcgagcaccat
ggcgtggctaacctagccaaggagccagatattattgcccacgcggtcaactctaggatc
gcatcgcacatgctaaatccgtcatttgatgcatcgggctttgaaatatatgctactctc
ttaaatggtgggacattagtgtgtattgacaacagcgtggtttttgactttccagcactg
ggcgctacatttatacagcacggaatcagacgtgccttcatgactcctgcaatcctaaaa
cagaccctggcctcctgtaacagtcttctgcgcatgttggatattctctatgttggcggc
gacaagctcgaccccggtgacgtagccaaagttcagcggctcaccaccggaagagtccaa
attttcaattgctacggaccgactgagaattccattgttagcaccaaataccgagtccca
gtggatgaggaaggtgtgaacggtgtccctatcggccggtcgatttccaacattggcgct
tatgtcgtggatcgtagtctccgactgctgccccttggggttctgggcgagctggtcgtc
acggggcccgcactagccagaggatatattgatccgaagcacgatatagggcgctttata
gaactggacatcagcgaagaagtagccccaatgcgtgcgtaccggactggggacatggtt
cgatatcgcccccgcgacgcccaactagagttctttggcaggatggatcagcaggttaag
gtccggggctatcgcgttgaactggctgagattgacaacactcttctgttgagtccgttt
atcagcgcggcagtgactgttgcgcggcaggaccaagaacttgtcagctttgttacagtg
tcagacatggcgtccggattcaacgaccgtgctgagactgaacacgtcgattcttggcta
gacgtcgttgaaggcgaggattactatggtagtgttggtaccattgagccacattcatta
ggggctgattttctaggctggatctccatgtacgatggggagccaattgacaagaacgac
atgcgcgaatggctacaagacaccattacagcgatactcagctgcagcccgtccagtgtt
cttgagatcggaacgggctccggaatgatcctcttcaatatcatcggcagcatccagaag
tacgttggcctggagccctccccccgggctgtggatttcgttagaagggcagtccattgg
gttccagaggctgccgggaaagttaatataaaatgcggcactgcatcagatattggacga
ctgcaggatatggggacccttgacctcgctgttatcaactcagtagcccagtatttcccc
tcgcttgactatctgcgtaacacgatcaaagaccttgtacgccagggcgtaaaaagcatc
ttcttgggcgacatccgctcatatgcgctgtaccaggagtttcaagtcagcaaggtcctt
cggctatatggccgcggtttaaccattaccagattccgccaacatatggccgagattgcc
cgtttggagaaggaactccttgttgacccagccttcttcacctcgttgccagcagaattg
ccgggcatgatcgagcacgtcgagatctggcctaagcgaatgaaggcaacgaacgaacta
agctgttatcggtacacggccgtgttgcacgtcaaacgtgctgaacagcccttgcttatt
cgagaggtcaaagagatatcatgggctgactttcaagcaaaggggtgggactacaactca
ctttcgcaaatgctagaaatcagcgatgcttccacagtcctggccgtggagaatatccca
tttaagaaaacgattgtcgagcgggacatggtacgtttactccaagagctgcctgaagac
accggttctgtcagctggagttcaaatgcccgcggacccaagagagcattggcgccaatc
gacctattcgacgtggccaaaaagacaggatgggacattgagatcagttgggcccgacaa
cggtcgcagcgcggcggtctggatgccgtctttcatcgacaaggcccacgggtgctcttc
cgatttccggttgacccctacatcccgggtgcatgcagtaacgatccactatcaccgcag
cggaatcggctacttgaaaagcacctactggagtacatgagcaccaagcttcctacgtac
atggtgccaaagctgatacatgtgctggacaagatgccaattaacaacatcggcaaggtc
gacagacatgttctcgcacaaagggctgccatcacgtcagctacaatatctgaatctgaa
tccttgtttcgaagggaaatagagcctgcattcacaagcgagattgagcgtgcagtgtgg
gaagaattcactggtgttctgggaagggaggttggcgtagcagacagctttttccgtaac
ggcgggcactccctgatggctatcaggttggtgtccaggattaacaagcggctctcttct
gccctgtcagtgagtgagctcttccgatatccgaccgtttctggtctcgcgcagcacctt
cagggcttgggggcccttgaaacccgagctgtcaccgtctacgcacctttctccttgctt
gacagaccgtacgatccgtctgaagtgcgcctacctccagaggctgatatagttgatgtc
accccggtaacagagtgtcaagcctggtttcttcaatgctggagcttggtttcgcactcg
ttcattatccatggagtgctggatgttgataggttacgcgccgcctgtcaggctgtagtg
agacatcaccctcctttacggactgtgttcaccgagtttcaaacccaactggttcaggct
ttcgacggggtctcgttgtccgccatcctttacgatattgctcgcgcctatgggaactcg
gcgtcaccattgagtaacgcagtaccattttctcaccacctgcatatgtgtcgttcaact
cgcccagatgcactggccttttggaaagcatacctgcgagatgccgtcttgactgaggtg
ccccgtccggaggaggtgaacgcgacaaacgagaaacctctggagatcatacagcaagaa
gcactaggcgaggttagtctgccgtccacagtcgacatcacattctctacccttgtcaat
gctgccattgcgttggcgcttgcccgtctggtccagcgcaacgatgttatctttgcctgc
gtcatgacctctcgtggtgttctcgccgagttggccgagtctgtcgtcggaccatgcgtc
aatcgctgtctgcttcgtgtcaaagtgcccgacgactcgaaccctgactcaacagcccta
gacttctgccgtaacttacgcgacaaccaagcccaggtttctggacacggtcacttgggg
ttccgtgacgtcgttgagaactgcacatcctgggcgtctttgggtgttgatgttggccgt
attgcttttgtaactcatctcccggcagagacagcactagaaacattttctcttactttg
ttagattcaccggtctcgtacgactcgacaaatgtgacaatcaatcctggcaaccagatt
ctggttcgctcggcgatcacagacgagcagcaagcctgtatacaggtcctatcatcgagc
aatgtgatgggcgccgagaaggccctgtttctagcgaacagaattttgatgatcgcgcag
agactgtcagtgtcggtgtcggggggcagatctcccagactattggaattggataagtag

DBGET integrated database retrieval system