KEGG   Aspergillus nidulans: AN9279.2Help
Entry
AN9279.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
ani  Aspergillus nidulans
Pathway
ani00330  Arginine and proline metabolism
ani01100  Metabolic pathways
ani01110  Biosynthesis of secondary metabolites
ani01130  Biosynthesis of antibiotics
ani01230  Biosynthesis of amino acids
Module
ani_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ani00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    AN9279.2
Enzymes [BR:ani01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     AN9279.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P5CR_dimer F420_oxidored ApbA IlvN NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-GeneID: 2867865
NCBI-ProteinID: XP_682548
UniProt: A0A1U8QSW3 Q5AR01
Position
VIII
AA seq 289 aa AA seqDB search
MGIDIDLTVAVIGCGTLGTAIAAGILDPKDKSGINIKRLIATVGTEPSKQRVRDALSTHE
SRLTVLTHGGNVRAIQEADVVLLAVKPFKRAEVFCAPGFKEAIRNKLVLSIMAGITTKEF
ARLAIGDGAAPGILQVVRAMPNMAAKIREAMTLYTPSPGTSPENLSIASWIFGQVGESHQ
IPEASFDICAVLVGCAGSLLLLAVDGLLDAAVAEGVRRSEVQNLVVNSAIGMLKLVPAGD
HPSVLREKIASPGGCSIQALLELERLGARSAFTRAIMAAAEKSKAMSSS
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgggaatcgacattgacctcacagtcgccgtcattggctgcggtaccttgggaactgcc
atcgcggctggtatcctcgatccaaaagacaagagtggcatcaacatcaagcgcttaata
gctacagtgggcacagagccctccaaacagcgtgtcagagatgcgctgtccacgcacgag
tcgcgattgacagtccttacgcatgggggcaatgttcgcgccatccaagaagcagacgtc
gtcttacttgctgtgaagcccttcaagcgagcagaggtcttctgtgctccagggttcaag
gaggccatccgcaacaagctcgttctcagcattatggcagggattacgacaaaggagttc
gctcgtcttgcgattggtgacggcgctgctccaggcattctgcaagttgtccgtgcgatg
cccaacatggctgccaaaatccgtgaggccatgacgctctacacccccagccccggcacg
agcccagagaatctaagtatcgcgtcctggatcttcggccaggttggcgaatctcatcag
atccccgaggcttccttcgacatctgcgccgttctagtgggatgtgcgggctctttgctg
cttcttgcagtcgatggtctcctagatgccgctgttgcagaaggtgtcaggagatccgag
gtgcagaacctggtcgttaacagcgctatcggtatgctgaagcttgttcctgctggagat
caccccagcgtcttgagagagaaaattgcttctcccggtggatgctcgatccaggctctg
ttggaattggagaggctgggggcacgctcggcctttacgagggctattatggcggccgcg
gagaagtccaaggccatgtcctcgtcctag

DBGET integrated database retrieval system