KEGG   Aspergillus nidulans: AN9288.2Help
Entry
AN9288.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
ani  Aspergillus nidulans
Pathway
ani00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:ani00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AN9288.2
Enzymes [BR:ani01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AN9288.2
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AN9288.2
    1.1.1.-  
     AN9288.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 2-Hacid_dh_C FAD_binding_3 ThiF
Motif
Other DBs
NCBI-GeneID: 2867887
NCBI-ProteinID: XP_682557
UniProt: A0A1U8QJQ4 Q5AQZ2
Position
VIII
AA seq 382 aa AA seqDB search
MAPTITALQYYGAKNVRLQQVQPRPCHADEVRIQIAYCGICGSDIHEYLGGPVFSPPPGK
KNPYTGAELPVTLGHEISGTIVELGSSVPASDPNLKLGMRVAVNPAMNDRHHGVEKCTAC
QLGLPNICKRYTSYGFSAAGGGLASEIVVKHYACIPLPDSISLKVGALLEPLAVAWHCIR
ISGFQRDQTVLILGAGPIGLAILMILRVWGVKTVVISEVAASRKRMARELGADLVLDPTE
LGSSKDGLDPVVVATQKAMKADGADVTFDCTGLQSTLDTAIAATRPGGTVFNVAIHEKPL
MVNLNELTLGERRLTGGICYTDVDFQELIAALEAGKIQAERLITSIVDLDDVIDKALMEL
IHNKAAHVKILVKPNHVRSVRL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggctcccaccatcacagctctccaatattacggagcgaaaaacgtaagactgcagcag
gttcagccgcgaccttgccatgcagatgaggtccgtatccagattgcctactgcggcatc
tgcggctctgacatccacgagtaccttggcggccccgtcttctcgcctcccccgggcaag
aagaacccgtatactggcgccgaactcccagtgacgctgggccacgaaattagtggaacg
atcgtcgagctcggctcgtcagtgccagcgtccgatccaaatctcaagctcggcatgaga
gtagccgtaaacccagccatgaatgatcgacaccatggggtagagaaatgcaccgcatgc
caactggggttgcccaatatctgcaagcggtatacatcgtacgggttcagtgccgcaggg
ggcgggctcgcgagcgaaatcgttgtcaagcattatgcctgcattccgctccctgattca
atctcgttgaaggtgggcgcgctcctggagccgctcgcggtggcgtggcactgtattcgg
atttctgggtttcaaagggaccagacggttctcatactcggtgccgggcctatcggccta
gcgattctgatgattctaagggtctggggggtcaagacggtcgttatcagtgaggtggcg
gcgtcacgaaagcggatggcgagggagctgggcgctgatctggtgctcgacccaactgag
ttggggagctctaaggatggactggatccagtggtcgtggctacgcaaaaggccatgaag
gcagacggggccgacgtgacattcgactgtacggggctgcaatccactctggacacggcc
attgctgcgaccagaccagggggcactgtcttcaacgtcgccatccatgaaaagcccctg
atggtgaatctcaacgagctgactctgggcgagaggcgcctgactggtggaatctgctac
acggacgttgatttccaggagctcattgctgctctggaagcagggaagattcaggccgag
aggctgattacatcgatcgtggatttagacgacgttattgacaaggcgctgatggagttg
atccataacaaggctgcgcatgtcaagatcttggtcaagccaaaccatgtgcggtcagtc
cgtctatag

DBGET integrated database retrieval system