KEGG   Aspergillus nidulans: AN9400.2Help
Entry
AN9400.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
ani  Aspergillus nidulans
Pathway
ani00970  Aminoacyl-tRNA biosynthesis
ani01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ani00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AN9400.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ani03029]
    AN9400.2
Enzymes [BR:ani01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AN9400.2
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AN9400.2
Mitochondrial biogenesis [BR:ani03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AN9400.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 2867928
NCBI-ProteinID: XP_682669
UniProt: Q5AQN0
Position
VIII
AA seq 559 aa AA seqDB search
MSLISNTIWKAQQREELMAAEARTTSGIPGSGRLHPPYASLFLNLCDNRSSGLMSLLLEA
ERYVANQSSNRMLNAFITPLCRHSGRWHDQAKDADIRGKQGKLRSRLDGRFIAFKDNICT
RDFPTTCASKSLDTFTSPFNATVVQQLEDAGAIVAGKTNLDEFGMGSHSIYSSFGHVMNT
RRGDDSKFLSAGGSSGGNAVAVATDQCYAALGTDTGGSIRLPAAYTGTVGFKPSYGLLSR
WGVIAYANSLDTVGILAKRVSVARDVFDVLNKHDPRDPTSISPSSRSRISSKLNLPQLTS
RLTSRPLRIGIPLEYNISELAPSVRQAWCHSLEYLRQQGHTIQPVSLPMTKLALSAYYVL
APAEASSNLAKYDGVRYGTRSDDSTENQSETYLYAKTRGAGFGPEVKRRIMLGAFSLSAQ
AIDNYFIQAQRIRRLVRHDFDAAFQAEHPLAAEIRNVELRQQAKQTGIDVLISPTAPTPP
PTISDITDTSTKRSNLDAYINDVFTVPASLAGLPAISVPVSGKDNAGNQEGDILAGIQVI
GQYGDDELVLKVGELLERR
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgtccttgatctcgaatacaatctggaaagctcagcagcgagaagagcttatggcggct
gaagcacggaccactagcggtattccgggttctggccgtctccatccgccatacgcatcg
ttgtttctcaatctttgcgacaatcgctccagcggcctaatgtccctcctgctcgaagct
gagagatatgtcgctaatcagagctcaaatcgcatgctcaatgccttcataactcctttg
tgccggcattcagggcggtggcatgatcaagcgaaagatgccgatattcggggaaagcaa
gggaagcttaggtcccgactggatggccggttcatcgcattcaaagataacatatgcact
cgcgacttccctacgacatgcgcctcgaaaagcctcgatacattcaccagtccgttcaat
gcaacggtagtccagcaactggaagatgcgggggccattgtcgccggaaagacgaatttg
gacgagttcggtatggggtctcattccatctattcgtcattcggacatgtcatgaataca
cgccggggtgatgattcaaaattcctctcggcaggaggaagttctggcggaaatgcagtt
gcggtcgctacggatcagtgctatgcggcactagggacggacacaggcggatcgattcgc
cttcctgccgcgtacaccggaactgttggctttaagccctcgtacgggctattatcccga
tggggtgttatcgcgtatgccaactcactagacaccgttgggatcttggcaaagcgagtt
tcagtggctcgagatgtatttgatgttttaaacaaacatgatccccgtgatccgacgagt
atttcgccgtcgtcaaggtccaggatatcctcgaagttgaacttgcctcagctcacctct
cgtctcacgtcccgcccccttcgcatcggcattccgctcgagtataacatctctgaactc
gccccttcagtgcggcaggcctggtgtcactccttggaatatttgcgtcagcagggacac
acaattcaacctgtatctttacctatgaccaagctagctttgtcagcgtactacgtactt
gccccagccgaagcatcttcaaatctagcgaaatatgacggcgtcagatacgggactcga
tcggacgacagcacagagaaccagtcagaaacctacctatatgcgaaaactagaggcgct
ggatttggcccagaggttaagcgacgaatcatgctaggcgcattcagtttgagcgctcag
gccattgataattacttcatccaagcacagcgcattcgacgtctggttcggcatgatttc
gatgccgctttccaggcagaacatcccctggccgccgaaatacgaaatgtcgaacttcgg
cagcaagctaaacaaactgggattgacgttcttatctcaccaactgcgcccaccccgccc
ccaaccatctcagatattacggataccagcacgaaaaggtcaaacttggatgcttatata
aatgatgtgttcacagtgcctgccagcttggccggccttccagccatatccgttcccgtc
tctggaaaggataatgctggcaatcaagaaggcgacatcctggctggcattcaggtaatc
ggccagtacggcgacgatgaacttgtgctcaaagtcggggaattgctagaaaggcgttaa

DBGET integrated database retrieval system