KEGG   Anaeromyxobacter sp. K: AnaeK_0040Help
Entry
AnaeK_0040        CDS       T00748                                 

Definition
(GenBank) Phenylacetate--CoA ligase
  KO
K01912  phenylacetate-CoA ligase [EC:6.2.1.30]
Organism
ank  Anaeromyxobacter sp. K
Pathway
ank00360  Phenylalanine metabolism
ank01100  Metabolic pathways
ank01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ank00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    AnaeK_0040
Enzymes [BR:ank01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.30  phenylacetate---CoA ligase
     AnaeK_0040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding_C_2 AMP-binding LuxE
Motif
Other DBs
NCBI-ProteinID: ACG71283
UniProt: B4UKJ2
Position
complement(49569..50894)
Genome map
AA seq 441 aa AA seqDB search
MARFALENRILDPEETLDRDALAALQGRRLAETVRRARAVPHHRKALERAGVRDEDLRGP
ADVRRLPFTVKDDLRQSYPLGLLAVPREQVVRIHGSSGTTGRPTFVAYTRRDLDTWTGLV
ARFLVAGGLRPEHTVHVAFGYGLFTGGFGLHYGIERVGAAVVPSGGGNTPRQVRLICDLS
ADVLISTPSYALHVGEVARAEGLKPGDLPLRYGHFGGEPWTEEMRGEIERSLGILAFNNY
GLSEVIGPGVAGECPARDGMHVQEDHFIVECLDPVTLEPVPDGEVGELVFTSLTKEAMPV
LRYRTRDLAALDRSPCPCGRTGVRMSRVRGRSDDMLIIRGVNVFPSQVEEALLRVEGTAP
HYLIEVSRPGALDEAVVKVEVRPEDFRDEMREMVGLRDRIDREIHAVTGIRMVVELVAPN
TLERSAGKARRVLDHRKAGPA
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcttcgcgctcgagaaccggatcctcgatccggaggagacgctcgaccgtgac
gcgctcgccgcgctccagggccgccgcctcgccgagaccgtccgccgcgcccgcgcggtg
ccgcaccaccgcaaggcgctggagcgggccggcgtccgcgacgaggacctgcgcggcccg
gccgacgtgcggcgcctgccgttcacggtgaaggacgacctccggcagagctacccgctc
ggcctgctggcggtgccgcgcgagcaggtggtgcgcatccacggctcctccggcaccacc
ggccgccccaccttcgtcgcctacacccgccgcgacctcgacacctggaccggcctggtg
gcccgcttcctggtggccggcgggctccgccccgagcacaccgtccacgtcgccttcggc
tacggcctgttcaccggcggcttcgggctgcactacggcatcgagcgggtgggcgccgcg
gtggtcccgtccggcggcgggaacacgccgcgccaggtgcggctcatctgcgacctctcc
gcggacgtgctcatcagcaccccgtcctacgcgctgcacgtgggcgaggtggcccgggcc
gaggggctgaagccgggcgacctgccgctccggtacggtcacttcggcggcgagccctgg
accgaggagatgcgcggggagatcgagcggtcgctcgggatcctcgccttcaacaactac
gggctgtccgaggtgatcgggccgggcgtcgccggcgagtgccccgcgcgcgacggcatg
cacgtgcaggaggaccacttcatcgtcgagtgcctcgacccggtcacgctcgagccggtg
ccggacggcgaggtgggcgagctcgtcttcacctcgctcaccaaggaggcgatgccggtg
ctgcgctaccgcacccgcgacctcgccgccctcgaccgctccccctgcccctgcggccgc
accggcgtgcgcatgagccgggtgcgcggccggtccgacgacatgctcatcatccgcggc
gtgaacgtgttcccgtcgcaggtggaggaggcgctgctccgcgtcgagggcaccgccccg
cactacctcatcgaggtctcgcgccccggagcgctcgacgaggcggtggtgaaggtggag
gtccggcccgaggacttccgcgacgagatgcgcgagatggtgggcctgcgcgaccgcatc
gatcgcgagatccacgcggtgaccgggatccggatggtcgtggagctggtggcgccgaac
acgctggagcgctccgccggcaaggcgcggcgggtgctcgaccaccggaaggccgggccg
gcgtag

DBGET integrated database retrieval system