KEGG   Anaeromyxobacter sp. K: AnaeK_1003Help
Entry
AnaeK_1003        CDS       T00748                                 

Definition
(GenBank) Threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ank  Anaeromyxobacter sp. K
Pathway
ank00260  Glycine, serine and threonine metabolism
ank01100  Metabolic pathways
ank01110  Biosynthesis of secondary metabolites
ank01120  Microbial metabolism in diverse environments
ank01130  Biosynthesis of antibiotics
ank01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ank00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AnaeK_1003
Enzymes [BR:ank01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     AnaeK_1003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ACG72238
UniProt: B4UFX0
Position
complement(1137158..1138243)
Genome map
AA seq 361 aa AA seqDB search
MNPGTPSHPAPPAPSGPLRHFASDNYGGICPEAFAAMAEANVGHSPGYGDDRWTQEAADL
LRETFETDCEVFFAFNGTAANSLALAALCQSYHSILCHETAHVETDECGAPEFFSNGTKV
LTLPGPNGKLRPDGIDHMVRRRTDIHYPKPRAVSVTLPTELGTLYTVDELGAIGERARAN
GLRFHMDGSRFGNAVAALGVAPKDLTWKVGVDVLCFGGTKAGMAVGEAIVFFDRALAADF
DYRCKQAGQLASKMRFLAAPWVGMLRGGAWLRHARHTNAMAALLERALRAVPGVEILQPV
QANSVFATLPGDAAARLRAKGWRFYDFIGSGGVRLMCAWDVTPADVEAFAADLRLAVAGP
R
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccggcaccccgtcccaccccgccccgcccgccccctcgggcccgctccgccac
ttcgcctccgacaactacggcggcatctgccccgaggcgttcgcggccatggccgaggcg
aacgtgggccactcgccgggctacggcgacgaccgctggacgcaggaggcggccgacctg
ctgcgcgagacgttcgagaccgactgcgaggtgttcttcgcgttcaacggcaccgccgcg
aactcgctcgcgctggccgcgctctgccagtcgtaccactcgatcctctgccacgagacg
gcgcacgtcgagaccgacgagtgcggcgcgccggagttcttctccaacggcaccaaggtc
ctcaccctgcccggcccgaacggcaagctccggcccgacggcatcgaccacatggtccgg
cgccgcaccgacatccactacccgaagccgcgcgcggtctcggtgacgctgccgaccgag
ctgggcacgctctacacggtggacgagctcggcgcgatcggcgagcgcgcccgggcgaac
gggctgcgcttccacatggacggctcgcggttcggcaacgcggtggcggcgctgggcgtc
gcccccaaggacctcacctggaaggtgggcgtggacgtgctctgcttcggcggcaccaag
gccggcatggcggtgggcgaggcgatcgtgttcttcgaccgcgcgctggcggccgacttc
gactaccgctgcaagcaggccgggcagctcgcgagcaagatgcgcttcctggcggcgccg
tgggtgggcatgctccggggcggtgcctggctgcgccacgcccggcacaccaacgcgatg
gccgcgctgctggagcgcgcgctccgcgccgtccccggggtggagatcctccagccggtg
caggcgaactcggtgttcgcgacgctgccgggcgacgccgccgcgcggctgcgcgcgaag
ggctggcgcttctacgacttcatcggctccggcggcgtccggctcatgtgcgcctgggac
gtgacgcccgccgacgtggaggcgttcgccgccgacctccggctggcggtggccggcccg
cgctag

DBGET integrated database retrieval system