KEGG   Anaeromyxobacter sp. K: AnaeK_1010Help
Entry
AnaeK_1010        CDS       T00748                                 

Definition
(GenBank) K potassium transporter
  KO
K03549  KUP system potassium uptake protein
Organism
ank  Anaeromyxobacter sp. K
Brite
KEGG Orthology (KO) [BR:ank00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ank02000]
    AnaeK_1010
Transporters [BR:ank02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   AnaeK_1010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: K_trans
Motif
Other DBs
NCBI-ProteinID: ACG72245
UniProt: B4UFX7
Position
1144880..1146895
Genome map
AA seq 671 aa AA seqDB search
MSQIPSPNDPASTGAAPSSAAVPAGPSATPAPSPTAGFSLPGHRPPPTGKALAALAVGAL
GVVYGDIGTSPLYSLKECFGGPHGVHPTDANVLGVLSLVFWAMTFVVTFKYMSFVMRADN
RGEGGILALMALVGKTETTRLGRRMLLMLGLFGAALLYGDGIITPAISVLGAVEGVAVAA
PAMERAVVPATVVILVFLFLFQKQGTAKVGAVFGPVMLVWFATIAVLGVRGILHDPTILR
ALLPTHGLSFFARNGWHGFLVLGGVVLVITGGEALYADMGHFGKRPIRVAWLGLAMPALL
LNYLGQGALLLHDPGAARNPFYLLAPEWALYPTIAIATAAAIVASQALISGAYSLTQQAI
QLGYSPRVTIRHTSQREIGQIYLPEVNWMLGTACLALVLGFQTSSRLASAYGIAVTGTMI
VTTLLFHRVMRDRWGWARWKAWPLTSLFLTVDASFFLANVVKFRDGGWFPIAAAALVFTL
MSTWKRGRDALALMLKDAGLPLDLFMADVARRKVQRVAGTAVFMTSNPGGVPPVLLHHLK
HNKVLHERVVLVSILAHEIPFVNEPERVNARELGSGFFQVIAHYGFMETPDVPALLDSLP
RRELAGPRITIVPMETTYFLGRETLLANGPSNIPTWRKRLFIVMARNAQTASAFFGLPPN
RVVEMGAQIQL
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagatcccctcacccaacgaccccgcgtcaaccggcgccgcgccctcgtccgcc
gccgttccggccggccccagcgccacgcccgccccgtcgcccacggccggcttctcgctg
cccgggcaccggccgccccccaccgggaaggcgctcgcggcgctcgcggtcggcgcgctc
ggggtcgtctacggggacatcgggacgagcccgctctactcgctgaaggagtgcttcggc
gggccgcacggggtccaccccaccgacgcgaacgtgctcggcgtcctgtcgctcgtgttc
tgggcgatgacgttcgtggtgacgttcaagtacatgtcgttcgtcatgcgcgcggacaac
cgcggggagggcgggatcctcgcgctcatggcgctggtggggaagaccgagaccacgcgc
ctcggccggcgcatgctgctcatgctgggcctgttcggcgccgcgctgctgtacggcgac
ggcatcatcacgcccgccatctcggtgctgggcgcggtggagggcgtcgccgtcgcggcg
ccggccatggagcgggcggtggtgccggccaccgtggtgatcctggtgttcctgttcctg
ttccagaagcagggcaccgccaaggtcggcgcggtgttcggcccggtcatgctggtctgg
ttcgcgaccatcgcggtgctgggcgtgcgcggcatcctccacgaccccaccatcctgcgc
gcgctcctgcccacccacgggctctccttcttcgcgcggaacggctggcacggcttcctg
gtgctgggcggcgtggtgctggtcatcaccggcggcgaggcgctctacgcggacatgggc
cacttcgggaagcgccccatccgcgtggcctggctgggcctcgccatgccggcgctgctc
ctcaactacctggggcagggggcgctgctgctccacgaccccggcgccgcccgcaacccg
ttctacctgctcgcgccggagtgggcgctctaccccaccatcgccatcgccaccgccgcg
gccatcgtggcctcgcaggccctcatctccggcgcgtactcgctcacccagcaggccatc
cagctcggctactcgccgcgcgtcaccatccgccacacctcgcagcgcgagatcgggcag
atctacctgcccgaggtgaactggatgctcggcaccgcctgcctggcgctggtgctcggg
ttccagacctcctcgcgcctcgcctccgcgtacggcatcgccgtcaccgggacgatgatc
gtcaccacgctcctgttccaccgggtgatgcgcgaccggtggggctgggcgcgctggaag
gcctggccgctcacgtccctgttcctcaccgtggacgcgtcgttcttcctcgcgaacgtg
gtcaagttccgcgacggcggctggttccccatcgcggcggcggcgctggtgttcacgctc
atgtccacctggaagcgcggccgcgacgcgctcgcgctcatgctgaaggacgccgggctc
ccgctcgacctgttcatggccgacgtggcgcggcgcaaggtccagcgcgtggccgggacc
gcggtgttcatgacctccaaccccggcggcgtcccgccggtgctgctccaccacctgaag
cacaacaaggtgctgcacgagcgcgtggtcctggtctcgatcctggcccacgagatcccg
ttcgtgaacgagccggagcgggtgaacgcgcgcgagctgggcagcggcttcttccaggtg
atcgcgcactacggcttcatggagacgccggacgtgccggccctgctcgactcgctcccc
cgccgcgagctggccgggccgcgcatcaccatcgtccccatggagacgacgtacttcctc
gggcgcgagacgctgctcgcgaacggcccgtcgaacatcccgacctggcgcaagcggctg
ttcatcgtgatggcccgcaacgcgcagaccgcgagcgcgttcttcggcctgccacccaac
cgcgtggtggagatgggcgcgcagatccagctgtag

DBGET integrated database retrieval system