KEGG   Anaeromyxobacter sp. K: AnaeK_1364Help
Entry
AnaeK_1364        CDS       T00748                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ank  Anaeromyxobacter sp. K
Pathway
ank00860  Porphyrin and chlorophyll metabolism
ank01100  Metabolic pathways
ank01110  Biosynthesis of secondary metabolites
ank01120  Microbial metabolism in diverse environments
Module
ank_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:ank00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AnaeK_1364
Enzymes [BR:ank01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     AnaeK_1364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Lipase_chap
Motif
Other DBs
NCBI-ProteinID: ACG72595
UniProt: B4UJ34
Position
1550329..1551123
Genome map
AA seq 264 aa AA seqDB search
MPAAPARPLAGRTVVVTRGKGSEGKDALAARLEELGAEVRALPSIAFAPPADPAPLDAAL
RALDRFDWAVFTSANAVDRTVERLRALGLDPAALGRLRLAAVGPATAERLAAAVRAPDVV
PVEAKGDVLARTLGDQVRGRRVLFPRPAEGRPETVAGLLAAGAELTAVEAYRTVPAPAEA
LAHLAGWLAAGDVAAVAFASPSAVAAVLAALGDRSALLRGVLIAAIGPTTADALREAGLP
VGAVPAHYTGRDLAEAIAERLGPG
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgccgcgcccgcgcggccgctggccggccgcaccgtggtggtgacccggggcaag
ggctccgagggcaaggacgcgctcgcggcccggctcgaggagctgggcgcggaggtgcgc
gcgctgccgtcgatcgcgttcgccccgcccgccgatcccgcgccgctcgacgccgccctc
cgcgcgctcgaccgcttcgactgggcggtgttcaccagcgcgaacgcggtggaccggacg
gtggagcggctgcgcgcgctcggcctcgatccggccgcgctgggccggctccgcctcgcc
gccgtcgggcccgccaccgccgagcggctggcggcggcggtgcgcgcgccggacgtggtg
ccggtcgaggcgaagggggacgtgctcgcccgcaccctgggcgaccaggtccgcggccgg
cgggtgctgttcccgcgcccggccgaggggcggcctgagaccgtggccgggctcctcgcc
gccggggccgagctgaccgcggtcgaggcgtaccggacggtccccgcgcccgccgaggcg
ctggcgcacctggcgggctggctcgcggccggtgacgtcgcggcggtcgccttcgcgtcg
ccctcggcggtggcggccgtgctggcggcgctcggtgaccggtcggccctcctccgaggg
gtgctgatcgcggcgatcgggcccaccaccgcggacgcgttgcgcgaggcggggctcccg
gtgggcgccgtcccggcgcactacaccggccgagacctcgcggaggccatcgccgagcgg
ctcggccccgggtag

DBGET integrated database retrieval system