KEGG   Anaeromyxobacter sp. K: AnaeK_1499Help
Entry
AnaeK_1499        CDS       T00748                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ank  Anaeromyxobacter sp. K
Pathway
ank00071  Fatty acid degradation
ank00072  Synthesis and degradation of ketone bodies
ank00280  Valine, leucine and isoleucine degradation
ank00310  Lysine degradation
ank00362  Benzoate degradation
ank00380  Tryptophan metabolism
ank00620  Pyruvate metabolism
ank00630  Glyoxylate and dicarboxylate metabolism
ank00640  Propanoate metabolism
ank00650  Butanoate metabolism
ank00900  Terpenoid backbone biosynthesis
ank01100  Metabolic pathways
ank01110  Biosynthesis of secondary metabolites
ank01120  Microbial metabolism in diverse environments
ank01130  Biosynthesis of antibiotics
ank01200  Carbon metabolism
ank01212  Fatty acid metabolism
ank02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ank00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AnaeK_1499
   00630 Glyoxylate and dicarboxylate metabolism
    AnaeK_1499
   00640 Propanoate metabolism
    AnaeK_1499
   00650 Butanoate metabolism
    AnaeK_1499
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AnaeK_1499
   00072 Synthesis and degradation of ketone bodies
    AnaeK_1499
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AnaeK_1499
   00310 Lysine degradation
    AnaeK_1499
   00380 Tryptophan metabolism
    AnaeK_1499
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AnaeK_1499
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AnaeK_1499
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AnaeK_1499
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ank04147]
    AnaeK_1499
Enzymes [BR:ank01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AnaeK_1499
Exosome [BR:ank04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AnaeK_1499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACG72730
UniProt: B4UK21
Position
1700096..1701277
Genome map
AA seq 393 aa AA seqDB search
MTGREVVIVGAARTPIGSFLGSLASVTAPRLGAVAIRAALARAGVEPSTVDEVVMGNVLQ
AGEGQAPARQAAIYAGLPEKTPAWTLNKVCGSGLKAVISAAQAIALGDADVVVAGGMESM
SNVPYYDRSARTGARMGNVELVDGMIHDGLWDVYGQQHMGMCAEHCAATQGIPRAAQDEY
AIESTRRAVEAWKAGAFKAEIVPVEIEGKKGEKTVVAEDDGPKGARPEKIPTLRPSFKKD
GTVTAGTSSSINDGAAALVLASAERAARDGLPVLGRLRAWGGAARAPVEFTIAPADAIRT
TLAKARLQVSDVDLWEINEAFAVVSIANNALLGLDPRKVNVRGGAVVLGHPIGASGARIL
VTLLQAMKDLDRRRGLASLCIGGGEAVALVVER
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaccggacgcgaagtggtcatcgtcggggcggcgcgcacgcccatcggctcgttcctc
ggctcgctcgcctcggtcaccgccccgcgcctcggcgcggtcgcgatccgcgccgcgctc
gcgcgcgccggggtcgagccctcgaccgtggacgaggtcgtgatgggcaacgtcctccag
gcgggcgaggggcaggcgccggcccggcaggcggcgatctacgcgggcctcccggagaag
acccccgcctggacgctcaacaaggtgtgcggctccggcctgaaggcggtgatctccgcc
gcgcaggccatcgccctcggcgacgccgacgtggtggtggcgggcgggatggagtcgatg
tccaacgtgccgtactacgatcggtccgcgcggaccggcgcgcggatgggcaacgtggag
ctggtggacgggatgatccacgacggcctctgggacgtgtacgggcagcagcacatgggc
atgtgcgccgagcactgcgccgccacgcaggggatcccccgcgccgcgcaggacgagtac
gcgatcgagtccacccgccgcgcggtcgaggcgtggaaggcgggggcgttcaaggccgag
atcgtcccggtggagatcgagggcaagaagggcgagaagacggtcgtggccgaggacgac
ggcccgaagggcgcgcggccggagaagatcccgacgctccggccgtcgttcaagaaggac
ggcaccgtcaccgccggcacctcctcgtccatcaacgacggggcggccgcgctggtgctc
gcgagcgccgagcgcgccgcgcgcgacgggctgccggtgctcgggcgcctgcgcgcctgg
ggcggcgccgcgcgggcgccggtggagttcaccatcgccccggccgacgcgatccggacc
acgctggcgaaggcgcggctccaggtctcggacgtggacctctgggagatcaacgaggcg
ttcgcggtggtgtcgatcgccaacaacgcgctgctcggcctcgacccgcgcaaggtgaac
gtgcgcggcggcgcggtggtgctgggccaccccatcggcgcctccggcgcgcgcatcctg
gtgacgctgctccaggccatgaaggacctcgatcgccggcgcggcctggcgtcgctctgc
atcggcggcggcgaggccgtcgcgctcgtggtggagcggtag

DBGET integrated database retrieval system