KEGG   Anaeromyxobacter sp. K: AnaeK_1744Help
Entry
AnaeK_1744        CDS       T00748                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ank  Anaeromyxobacter sp. K
Pathway
ank00010  Glycolysis / Gluconeogenesis
ank00020  Citrate cycle (TCA cycle)
ank00620  Pyruvate metabolism
ank01100  Metabolic pathways
ank01110  Biosynthesis of secondary metabolites
ank01120  Microbial metabolism in diverse environments
ank01130  Biosynthesis of antibiotics
ank01200  Carbon metabolism
Module
ank_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ank00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AnaeK_1744
   00020 Citrate cycle (TCA cycle)
    AnaeK_1744
   00620 Pyruvate metabolism
    AnaeK_1744
Enzymes [BR:ank01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AnaeK_1744
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H PYNP_C HlyD_D23 HlyD_3 NQRA RnfC_N
Motif
Other DBs
NCBI-ProteinID: ACG72973
UniProt: B4UMF2
Position
complement(1972060..1973733)
Genome map
AA seq 557 aa AA seqDB search
MRTIEVKVPNIGDYKDVPVIDVLVKPGEQVDADAPLVTLESDKATLDVPAPAAGTIREVK
VKVGDRVSEGSLVVTLEAADGQAKAEAPAAPAQAAPAKPAAAAPAPAPSPAPAAPSAPPA
AAAPAGAPRTVEVKVPNIGDFKDVPVIEVLVKPGDRVEADAPLATLESEKATLDVPAPAA
GTIREVALKAGDKVSEGSLVAILDAVAPAAGTTGAAPPPAAPAPSQPAAAPAAKAAAPAP
ATAPAAPPVAPEAGAQGQVPHASPSVRKLARELGANLARVEGTGPRGRILQDDVQKFVKA
SLARLEAGGGGGGALDLAPWPKVDFTRFGPVERQPLSRIRKLSRTNLARNWVMIPHVTQF
DEADITELERFRVELNREHEKQGVKVTLLAFLVKACVAAMKRFPELNASLDGDELVLKRY
FHVGFAADTPQGLVVPVLRDADQKGVLQLAKELGELAAKARDGKLSPADVQGGCFSISSL
GGIGGTAFTPIINAPEVAILGVSRSAMRPVWDGAQFQPRLMLPLSLSYDHRVIDGALAAR
ITTYLGQLLGDLRRIVL
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaccatcgaggtcaaggtcccgaacatcggcgactacaaggacgtcccggtcatc
gacgtgctggtgaagcccggcgagcaggtggacgccgacgcgccgctggtcacgctcgag
tcggacaaggccaccctggacgtgcccgcccccgcggccggcaccatccgcgaggtgaag
gtgaaggtcggcgaccgcgtcagcgagggatcgctggtggtcaccctggaggcggcggac
gggcaggccaaggcggaggcgcccgccgcgcccgcccaggccgcgcccgcgaagcccgcc
gccgcggcgcccgcgccggcgccctcccctgcccctgctgcgccctccgcgcctccggcc
gcggccgcgccggcgggcgcgccgcgcacggtggaggtgaaggtcccgaacatcggcgac
ttcaaggacgtcccggtcatcgaggtgctggtgaagccgggcgatcgggtcgaggccgac
gcgccgctcgccacgctcgagtcggagaaggccacgctcgacgtgcccgcgcccgcggcc
ggcacgatccgcgaggtggcgctgaaggccggggacaaggtgagcgagggatcgctggtg
gcgatcctggacgcggtcgcgcccgccgccgggacgaccggcgccgcgccaccgcccgcc
gcgccggccccgtcccagcccgccgcggctcccgcagcgaaggccgccgcgccggccccg
gcgacggcccccgccgcgccaccggtcgcgccggaggccggtgcccagggccaggtgccg
cacgcctcgccctcggtccgcaagctcgcccgcgagctgggcgccaacctggcccgcgtc
gaggggaccggcccgcgcggccgcatcctgcaggacgacgtgcagaagttcgtgaaggcc
tcgctcgcccggctcgaggcgggcggcggcgggggcggcgcgctcgacctcgcgccctgg
cccaaggtggacttcacccgcttcgggccggtggagcggcagccgctctcgcgcatccgc
aagctgtcgcggaccaacctggcgcggaactgggtgatgatcccgcacgtcacgcagttc
gacgaggcggacatcaccgagctggagcgcttccgcgtcgagctgaaccgcgagcacgag
aagcagggcgtgaaggtgacgctgctcgcgttcctggtgaaggcctgcgtcgccgccatg
aagcgcttccccgagctgaacgcctcgctcgacggggacgagctggtgctgaagcgctac
ttccacgtcggcttcgccgccgacacgccgcaggggctggtggtgccggtgctgcgggac
gccgatcagaagggcgtcctgcagctcgcgaaggagctgggcgagctcgccgcgaaggcg
cgcgacgggaagctctcccccgccgacgtgcagggcggctgcttctccatctccagcctg
ggcggcatcggcggcaccgcgttcacgcccatcatcaacgcaccggaggtggccatcctg
ggcgtctcgcggagcgccatgcgcccggtgtgggacggcgcgcagttccagccccggctg
atgctgccgctgtccctctcctacgaccaccgcgtcatcgacggcgcgctggcggcgcgg
atcacgacgtacctgggccagctcctcggcgacctgcggcggatcgtgctctag

DBGET integrated database retrieval system