KEGG   Anaeromyxobacter sp. K: AnaeK_1792Help
Entry
AnaeK_1792        CDS       T00748                                 

Definition
(GenBank) Diphosphate--fructose-6-phosphate 1-phosphotransferase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
ank  Anaeromyxobacter sp. K
Pathway
ank00010  Glycolysis / Gluconeogenesis
ank00030  Pentose phosphate pathway
ank00051  Fructose and mannose metabolism
ank00052  Galactose metabolism
ank00680  Methane metabolism
ank01100  Metabolic pathways
ank01110  Biosynthesis of secondary metabolites
ank01120  Microbial metabolism in diverse environments
ank01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ank00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AnaeK_1792
   00030 Pentose phosphate pathway
    AnaeK_1792
   00051 Fructose and mannose metabolism
    AnaeK_1792
   00052 Galactose metabolism
    AnaeK_1792
  Energy metabolism
   00680 Methane metabolism
    AnaeK_1792
Enzymes [BR:ank01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AnaeK_1792
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     AnaeK_1792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ACG73021
UniProt: B4UMK0
Position
complement(2038007..2039191)
Genome map
AA seq 394 aa AA seqDB search
MTKKRVGILTGGGDVPGLNSVIKSVVYRGAEHDIEVVGIRRGWEGLTHLDLTDSASKARY
VWPLDRENTRTIDRTGGTILHSSRTNPAKMKKLPPHLQGTSFPTSTSTKGGTATTTFDVS
KQVLANLEALGLDYLLAIGGDDTLSYAARLHDLGFKVIAIPKTMDNDVRNTEYCIGFSTA
ITRAMDAIERQRTTVGSHERIGVFRVFGRDAGFTSLYTAYVTSIRCLIPEHKPKIEHVVD
LLVTDKRDNPSGYALIVLSEGAQWEGYAVQEYGDPDAFGHRKKASVGESLSDEIKRRTGE
ETIVSDLTYDLRSGDPDFIDKLIAYTFGTMAFDAVLEGKSGLMSALVDGRYDLVPIPDPK
LGPRKVDVASMYNTDRLRPIYANKRGLPVFLNKI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagaagcgcgtcggcatcctcaccggcggcggcgacgtccccggcctgaacagc
gtcatcaagagcgtcgtgtaccgcggcgccgagcacgacatcgaggtcgtgggcatccgg
cgcgggtgggaggggctcacccacctcgacctcaccgactccgccagcaaggcgcgctac
gtctggccgctcgaccgcgagaacacccgcaccatcgaccggaccggcggcaccatcctc
cactcctcgcggacgaatcccgcgaagatgaagaagctgccgccgcacctgcaggggacg
tcgttcccgacctcgaccagcaccaagggcgggacggccaccaccaccttcgacgtctcg
aagcaggtgctcgcgaacctggaggcgctcgggctcgactacctgctcgccatcggcggc
gacgacacgctgtcctacgcggccaggctccacgacctcgggttcaaggtcatcgcgatc
ccgaagaccatggacaacgacgtccggaacaccgagtactgcatcgggttctcgaccgcg
atcacccgcgccatggacgcgatcgagcgccagcgcaccacggtcggctcgcacgagcgc
atcggcgtcttccgggtgttcggccgcgacgcggggttcacctcgctctacaccgcctac
gtcacctcgatccgctgcctcatccccgagcacaagccgaagatcgagcacgtggtggac
ctgctggtcaccgacaagcgcgacaacccctcgggctacgcgctcatcgtgctctccgag
ggcgcgcagtgggagggctacgcggtgcaggagtacggcgaccccgacgcgttcggccac
cgcaagaaggccagcgtgggcgagtcgctctccgacgagatcaagcggcgcaccggcgag
gagacgatcgtctccgacctgacctacgacctgcgctcgggcgatcccgacttcatcgac
aagctcatcgcgtacaccttcggcaccatggcgttcgacgcggtgctggagggcaagagc
ggcctcatgtcggcgctggtggacgggcgctacgacctcgtccccatccccgacccgaag
ctcgggccccgcaaggtggacgtggcgagcatgtacaacaccgaccgcctgcgcccgatc
tacgcgaacaagcgcgggctgccggtgttcctcaacaagatctga

DBGET integrated database retrieval system