KEGG   Anaeromyxobacter sp. K: AnaeK_2035Help
Entry
AnaeK_2035        CDS       T00748                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ank  Anaeromyxobacter sp. K
Pathway
ank00010  Glycolysis / Gluconeogenesis
ank00020  Citrate cycle (TCA cycle)
ank00620  Pyruvate metabolism
ank01100  Metabolic pathways
ank01110  Biosynthesis of secondary metabolites
ank01120  Microbial metabolism in diverse environments
ank01130  Biosynthesis of antibiotics
ank01200  Carbon metabolism
Module
ank_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ank00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AnaeK_2035
   00020 Citrate cycle (TCA cycle)
    AnaeK_2035
   00620 Pyruvate metabolism
    AnaeK_2035
Enzymes [BR:ank01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AnaeK_2035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: ACG73263
UniProt: B4UC32
Position
2283517..2284839
Genome map
AA seq 440 aa AA seqDB search
MAYKLELPDIGEGVVEAEVQQWFVAPGDAITEDQPLVEVMTDKATVVIPSPKRGTVVKLF
WNVGDVAKVHSPLVEIELDDAPPRPAPEAPVRAATAAATAQAAAAASVAVGRPAHPEEAT
PAAAPAAPAPAGAKALATPAVRAMARELGIDVNTVPGTGPGGRVTKDDLSRARGKVNGHG
GETEVPAPAPAAARAPVPAPSPAGPPEADERIPLRGMRRKIAENMARSKRTAAHFTFVEQ
ADVTELVRVKDRIAAAAKEEGVRVTFLPFVVKAVVAALRKFPKLNASLDDERGEIVVKHR
YDLGVASATDAGLVVPVIRAADRRSLLDLAREIERLSQDTKAGRIRPEDLGSSTFTITSL
GALGGLFATPVLNHPEVGILGIHRIRPTPVVRDGQIVARDVMHVSLTSDHRVVDGHEAAA
FTYQVIKYLEDPNLLFMQMV
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggcctacaagctcgagctccccgacatcggcgagggggtcgtcgaggcggaggtccag
cagtggttcgtcgccccgggcgacgcgatcaccgaggaccagccgctcgtcgaggtgatg
accgacaaggcgacggtggtgatcccgtcgccgaagcgcggcacggtcgtgaagctgttc
tggaacgtgggagacgtggccaaggtgcactcgccgctggtcgagatcgagctcgacgac
gcgccgccgcgcccggcgcccgaggcgccggtgcgcgccgccaccgcggcggcgacggcg
caggcggccgcggcggcgtcggtggcggtcggccgccccgcccacccggaggaggccacg
ccggcggccgcacccgccgcccccgcgcccgcgggcgcgaaggcgctcgccacccccgcc
gtgcgcgccatggcgcgggagctggggatcgacgtgaacacggtgccgggcaccggcccg
ggcggccgcgtcaccaaggacgacctgtcgcgcgcccgcggcaaggtgaacgggcacggc
ggcgagacggaggtgccggccccggcgcccgccgcggcccgcgccccggtgccggcgccg
tcgccggccggcccgccggaggcggacgagcgcatcccgctgcgcggcatgcggcggaag
atcgccgagaacatggcgcgctcgaagcggaccgccgcccacttcacgttcgtggagcag
gcggacgtcaccgagctggtccgggtgaaggaccggatcgccgccgccgcgaaggaggag
ggcgtccgcgtgacgttcctgccgttcgtggtgaaggcggtcgtcgcggcgctgcgcaag
ttcccgaagctgaacgcgtcgctcgacgacgagcgcggcgagatcgtggtgaagcaccgg
tacgacctgggcgtcgcctcggccaccgacgcgggcctggtggtcccggtgatccgcgcg
gccgatcgccgctcgctcctcgatctcgcccgggagatcgagcggctctcgcaggacacc
aaggccgggcgcatccgccccgaggacctgggcagctccacgttcaccatcaccagcctg
ggcgcgctgggcgggctgttcgccaccccggtgctgaaccaccccgaggtcggcatcctg
ggcatccaccgcatccggcccacgccggtggtgcgcgacgggcagatcgtcgcccgcgac
gtgatgcacgtctcgctcacgagcgaccaccgcgtggtggacgggcacgaggcggccgcg
ttcacctaccaggtgatcaagtacctcgaggatcccaacctgctgttcatgcagatggtg
tga

DBGET integrated database retrieval system