KEGG   Anaeromyxobacter sp. K: AnaeK_2335Help
Entry
AnaeK_2335        CDS       T00748                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ank  Anaeromyxobacter sp. K
Pathway
ank00010  Glycolysis / Gluconeogenesis
ank00051  Fructose and mannose metabolism
ank00562  Inositol phosphate metabolism
ank01100  Metabolic pathways
ank01110  Biosynthesis of secondary metabolites
ank01120  Microbial metabolism in diverse environments
ank01130  Biosynthesis of antibiotics
ank01200  Carbon metabolism
ank01230  Biosynthesis of amino acids
Module
ank_M00002  Glycolysis, core module involving three-carbon compounds
ank_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ank00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AnaeK_2335
   00051 Fructose and mannose metabolism
    AnaeK_2335
   00562 Inositol phosphate metabolism
    AnaeK_2335
Enzymes [BR:ank01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     AnaeK_2335
Exosome [BR:ank04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   AnaeK_2335
  Exosomal proteins of bladder cancer cells
   AnaeK_2335
  Exosomal proteins of melanoma cells
   AnaeK_2335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM VBS
Motif
Other DBs
NCBI-ProteinID: ACG73562
UniProt: B4UEJ1
Position
complement(2617159..2617920)
Genome map
AA seq 253 aa AA seqDB search
MARTKFVCGNWKMHKTVAEAVQLVKELAAGLGDAAGKVQVAVAPPFTALHAAAQAAAGSA
VEVAGQDVHWEVQGAFTGEVSAAMLAEAGCRHGIVGHSERRQLFGETDEAVRRKAEALLA
AGLAPIVCVGETLAEREAGRTLEVVDRQVRQGLAGLDAGALGRVTVAYEPVWAIGTGKTA
TAAQAQEVHAAIRKILRDLGGSVSDAIRIQYGGSVKPENAQELMSQPDVDGALVGGASLK
AKDFLAIVKGALR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtggcccgcaccaagttcgtctgcggcaactggaagatgcacaagacggtcgccgaggcg
gtccagctcgtgaaggagctggccgccgggctcggcgacgccgccgggaaggtgcaggtg
gcggtggcgccgcccttcaccgccctccacgccgccgcgcaggccgcggccggctcggcg
gtcgaggtcgcggggcaggacgtgcactgggaggtccagggcgcgttcaccggcgaggtg
tccgccgcgatgctggcggaggcgggctgccgccacggcatcgtgggccacagcgagcgg
cgccagctgttcggcgagaccgacgaggccgtccgcaggaaggccgaggcgctgctcgcc
gccgggctcgcgcccatcgtctgcgtcggcgagacgctcgccgagcgcgaggccggccgg
acgctggaggtggtcgaccggcaggtgcggcaggggctcgccgggctggacgccggcgcg
ctgggccgggtgacggtcgcctacgagccggtgtgggccatcggtaccgggaagaccgcc
accgccgcccaggcgcaggaggtccacgccgccatccggaagatcctccgcgatctgggg
ggttccgtgtcggacgcgatccggattcaatacggcggctcggtgaagcccgagaacgct
caggagctcatgtcccagcccgacgtcgacggcgcgctcgtcggcggggccagcctcaag
gcgaaggatttcctcgccatcgtgaaaggtgcactccgttga

DBGET integrated database retrieval system