KEGG   Anaeromyxobacter sp. K: AnaeK_3805Help
Entry
AnaeK_3805        CDS       T00748                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ank  Anaeromyxobacter sp. K
Pathway
ank00260  Glycine, serine and threonine metabolism
ank00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ank01100  Metabolic pathways
ank01110  Biosynthesis of secondary metabolites
ank01130  Biosynthesis of antibiotics
ank01230  Biosynthesis of amino acids
Module
ank_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ank00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AnaeK_3805
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AnaeK_3805
Enzymes [BR:ank01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AnaeK_3805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACG75016
UniProt: B4UE58
Position
4283178..4284533
Genome map
AA seq 451 aa AA seqDB search
MQTKFLLGENQIPTHWYNVIPDLPEPLSPVIHPATGKPASPDDLVRIFPPQLIEQEVSTQ
RWIQIPEPVREIYRLWRPAPLFRAHRLERVLGTPAHIYYKYEGVSPAGSHKPNTAVPQAY
YNKLAGTKRLATETGAGQWGSSIALAAQMFGLACTVYMVKVSYGQKPYRRSMMQLWGAEV
IPSPSDRTAAGRGILAEDPESPGSLGVAISEAVEDAVTHEDTRYALGSVLNHVCLHQTVI
GLEAKEQLKLAGEYPDVVIGCHGGGSNFAGIGFPFLADKAAGKDVRILAIEPSSCPTLTK
GAYTFDYGDTARMAPIMRMYTLGHDFMPPGIHAGGLRYHGASPLVSQLVHAGLVEARAVG
QLACFEAAVQFARAEGIIPAPESSHAIRGAVEEALRAKEEGKERVILFNLSGHGHVDMTS
YDQFLSGKLDDFEYPEEKVRASLAHLPKVEL
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgcagacgaagttcctgctcggcgagaaccagatccccacccactggtacaacgtcatc
ccggacctgcccgagccgctgtccccggtcatccaccccgccaccggcaagccggccagc
ccggacgacctggtccggatcttcccgccgcagctcatcgagcaggaggtctcgacccag
cgctggatccagatccccgagccggtccgcgagatctaccggctgtggcggccggccccg
ctgttccgcgcccaccggctggagcgggtgctcgggacgcccgcgcacatctactacaag
tacgagggcgtctcgccggccggctcgcacaagccgaacaccgcggtgccgcaggcctac
tacaacaagctcgccggcacgaagcgcctcgccaccgagaccggcgccgggcagtggggc
tcgtccatcgcgctcgcggcgcagatgttcgggctcgcctgcacggtctacatggtgaag
gtgtcgtacgggcagaagccgtaccgccgcagcatgatgcagctgtggggcgcggaggtg
atcccctcgccctccgaccgcaccgccgccggccgcgggatcctcgccgaggatccggag
agccccggctcgctcggcgtggcgatctccgaggcggtggaggacgcggtcacccacgag
gacacgcgctacgcgctcggcagcgtgctgaaccacgtctgcctgcaccagacggtgatc
gggctcgaggcgaaggagcagctcaagctcgccggcgagtaccccgacgtcgtcatcgga
tgccacggcggcggctccaacttcgccggcatcggcttcccgttcctcgccgacaaggcc
gccggcaaggacgtgcgcatcctcgccatcgagccgtcgtcctgccccacgctgacgaag
ggcgcctacaccttcgactacggcgacaccgccaggatggcgcccatcatgcggatgtac
acgctgggtcacgacttcatgccgcccggcatccacgccggcggcctgcgctaccacggc
gcgtcgccgctcgtgtcgcagctcgtgcacgcgggcctggtggaggcgcgcgcggtgggg
cagctcgcctgcttcgaggcggcggtgcagttcgcccgggccgaggggatcatccccgcg
ccggagtcctcgcacgcgatccgcggcgcggtcgaggaggcgctgcgcgcgaaggaggag
gggaaggagcgggtgatcctgttcaacctctccggccacggccacgtggacatgacgtcg
tacgaccagttcctctccggcaagctcgacgacttcgagtacccggaggagaaggtgcgc
gcgtcgctcgcgcacctgcccaaggtggagctgtag

DBGET integrated database retrieval system