KEGG   Anaeromyxobacter sp. K: AnaeK_4399Help
Entry
AnaeK_4399        CDS       T00748                                 

Definition
(GenBank) glycoside hydrolase family 3 domain protein
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ank  Anaeromyxobacter sp. K
Pathway
ank00520  Amino sugar and nucleotide sugar metabolism
ank01100  Metabolic pathways
ank01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ank00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AnaeK_4399
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    AnaeK_4399
Enzymes [BR:ank01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     AnaeK_4399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: ACG75602
UniProt: B4UJM1
Position
complement(4946931..4948028)
Genome map
AA seq 365 aa AA seqDB search
MPTPTSLDAQVAGLFCVGFDGKTASPEVLELIRRGVHGVVLFARNVESAEQVAALTAELK
RAAGRPLLVAVDQEGGRVARLRARHGFTELPPMRAVGEVGDAALAREVGALLGRELRAVG
IDQDYAPVVDVDTNPANPVIGDRSLSRDPETVGRLGAAIALGLQSAGVAACAKHFPGHGD
TSQDSHTDLPRLPHALERLRAVELAPFRALARAGVASVMTAHVVFEALDRDRPATLSPAV
MRLLREEVGFDGCAISDDLEMQAVAGHFPLEESAPGAVAAGVDALLVCHSPAVQHRAIDL
VRAAVEAGRIPGDRVAEARGRVGRLLAYAGPPPDPARVRERLRTPEHLALVENVPALEIG
RDPTA
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
gtgcccaccccgacctccctcgacgcccaggtcgccggcctgttctgcgtcggcttcgac
ggcaagaccgcctcgcccgaggtgctcgagctcatccgccgcggcgtccacggcgtggtg
ctgttcgcccgcaacgtggagagcgccgagcaggtggcggcgctcaccgccgagctgaag
cgcgccgcggggcggccgctgctcgtggcggtggaccaggagggcgggcgggtggcgcgg
ctgcgggcgcgccacggcttcaccgagctcccgcccatgcgcgcggtgggcgaggtcggc
gacgccgcgctggcgcgcgaggtgggcgcgctgctcggccgcgagctgcgggcggtcggc
atcgaccaggactacgcgccggtggtggacgtggacaccaaccccgccaacccggtcatc
ggcgaccgcagcctgtcccgcgatccggagacggtcggccgcctcggcgccgccatcgcg
ctcgggctccagtcggccggggtggccgcctgcgcgaagcacttccccgggcacggcgac
acgagccaggactcgcacaccgacctgccccgcctcccgcacgcgctggagcggctccgg
gcggtggagctcgcgccgttccgcgcgctggcgcgcgccggggtggcctcggtgatgacc
gcgcacgtggtgttcgaggcgctcgaccgcgaccgcccggccacgctctcgccggcggtg
atgcggctgctgcgcgaggaggtcggcttcgacggctgcgccatctccgacgacctggag
atgcaggcggtggccgggcacttcccgctcgaggagtccgcgcccggcgcggtggcggcc
ggggtggacgcgctgctcgtctgccactcgcccgcggtacagcaccgggccatcgacctc
gtgcgtgccgcggtggaggcgggtcgcatcccgggggaccgggtcgccgaggcccggggc
cgggtgggtcggctgctcgcctacgcgggcccgccgccggacccggcccgggtgcgggag
cggctgcgcacgccggagcacctggcgctggtcgagaacgtccccgcgctcgagatcggc
cgcgacccgaccgcctga

DBGET integrated database retrieval system