KEGG   Anoxybacillus sp. B7M1: GFC29_1272Help
Entry
GFC29_1272        CDS       T04426                                 

Definition
(GenBank) zinc-binding dehydrogenase family protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
anl  Anoxybacillus sp. B7M1
Pathway
anl00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:anl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    GFC29_1272
Enzymes [BR:anl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     GFC29_1272
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     GFC29_1272
    1.1.1.-  
     GFC29_1272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C 2-Hacid_dh_C ADH_N_assoc TrkA_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ANB64766
UniProt: A0A160FCE2
Position
complement(1300585..1301643)
Genome map
AA seq 352 aa AA seqDB search
MKAARWYQARDIRVEEVPEPKAEAGQVKIKVAYAGICGSDLHEYLAGPIFVPVKEPHPLS
KDKAPIIMGHEYAGEVVEVGEGVGRIQVGDRVCVEPIYSCGECPSCRKGHYNVCEKLGFV
GLSGGYGGFAEYSVVPAHMVHKIPDHMSWEQAALVEPTAVAVHAVRQSGLQIGDTVAVFG
AGPIGLLVIQAARAAGASNIIAVEVSPERQELARKVGTDLVIHPLEQEAVAEIFAYTEGL
GADVSFEVAGVEATLNMAVAATRPEGNIVNVSIWEKPASLPVNHLVLTERKMTSIIAYRN
IFPQVIRLIANGQINASDLVTSYIRLDEIVPKGFEALTTQKSQIKILVQPSI
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggctagatggtatcaggcgagagatattcgcgtagaggaggttccagagccg
aaagcggaggcgggacaagtaaaaattaaagtagcatatgcggggatttgcggttcagat
ttacatgaatatttagcagggcctatttttgtgccggtaaaggaaccacatccgctttca
aaggacaaagcaccgattattatggggcatgagtatgctggagaggttgtcgaagtcgga
gaaggtgtaggacgtattcaggtgggcgaccgcgtttgtgtggaaccgatttatagctgc
ggcgagtgtccgtcttgccgaaaagggcattataacgtttgtgaaaagttgggatttgtt
ggtctatctggaggatacgggggatttgccgaatatagcgtggttccggcccacatggtg
cataaaattcctgatcacatgtcatgggagcaagctgcattggtggagcctacagcagta
gctgttcatgctgtgcgccaaagtggtttacagattggagatacagtagctgtgtttggt
gcgggaccgattggcttgcttgtcattcaagcggcgagagcagcaggggcaagcaacatt
attgcggtggaggtttcaccagagcgtcaggagcttgcccggaaggtaggcacggatctg
gtcatccatcccttagagcaggaagctgttgccgaaatttttgcttatacagaagggctt
ggggcagatgtctcatttgaggtagcaggcgttgaggcaacgctgaatatggcggttgcg
gcgacaaggcctgagggaaatattgtgaatgtgagtatctgggagaagccggcatctttg
ccagtaaaccatttagtgttgaccgagcggaagatgacaagcatcattgcttaccgcaat
atttttccacaggtcattcgtttaattgcgaatggtcaaatcaacgcctcggatcttgtg
acaagctatattcgtttagatgaaattgtaccaaaagggtttgaagcgttaacgactcaa
aaaagccaaatcaaaattctagttcagccgtctatataa

DBGET integrated database retrieval system