KEGG   Anoxybacillus sp. B7M1: GFC29_1813Help
Entry
GFC29_1813        CDS       T04426                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
anl  Anoxybacillus sp. B7M1
Pathway
anl00071  Fatty acid degradation
anl00072  Synthesis and degradation of ketone bodies
anl00280  Valine, leucine and isoleucine degradation
anl00310  Lysine degradation
anl00362  Benzoate degradation
anl00380  Tryptophan metabolism
anl00620  Pyruvate metabolism
anl00630  Glyoxylate and dicarboxylate metabolism
anl00640  Propanoate metabolism
anl00650  Butanoate metabolism
anl00900  Terpenoid backbone biosynthesis
anl01100  Metabolic pathways
anl01110  Biosynthesis of secondary metabolites
anl01120  Microbial metabolism in diverse environments
anl01130  Biosynthesis of antibiotics
anl01200  Carbon metabolism
anl01212  Fatty acid metabolism
anl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:anl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GFC29_1813
   00630 Glyoxylate and dicarboxylate metabolism
    GFC29_1813
   00640 Propanoate metabolism
    GFC29_1813
   00650 Butanoate metabolism
    GFC29_1813
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GFC29_1813
   00072 Synthesis and degradation of ketone bodies
    GFC29_1813
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GFC29_1813
   00310 Lysine degradation
    GFC29_1813
   00380 Tryptophan metabolism
    GFC29_1813
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GFC29_1813
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GFC29_1813
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GFC29_1813
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:anl04147]
    GFC29_1813
Enzymes [BR:anl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     GFC29_1813
Exosome [BR:anl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GFC29_1813
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD
Motif
Other DBs
NCBI-ProteinID: ANB63128
UniProt: A0A160F8T0
Position
complement(1821057..1822235)
Genome map
AA seq 392 aa AA seqDB search
MRTDIVLVEGARTAFAEFCGSFREISATDLGAIAARGAMKKANVEPEEIDHVVFGNVQQS
SRDAHLLARHVGLKAGLSIDVPAVTVNRLCGTGLETIIMAARLILTGEAEVILAGGTENM
SQVPHVIRGMRWGTRLGSLTVEDWVWDGLYDTVGGCSMAMTAENLAKEYHITREEVDQHA
LRSHERALEAIKKGYFRQEIVPVTVQERNRETIVDTDEHPRQTSLEQLRALHPRFLENGV
VTPGNASGINDGAAAVIIASGDYAAKRGLKPLARLVSWGVVGVEPKYMGIGPVPAIRQAL
KNAKLSIDDLDLIEINEAFSAQYLACQKELGFDDEKGNVNGGAVALGHPLAASGTRITLT
LIYELARRKKKYGVSSLCIGGGQGIAAVWERL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcggacagacattgtattggttgaaggagcgcgcacggcgttcgccgaattttgtggt
tcgtttcgcgagatttctgcaaccgatctcggggccatcgcggcgaggggggcgatgaaa
aaggcgaacgtcgaaccggaagaaatcgatcatgtcgtgtttggcaacgttcaacaatca
agccgggatgctcatttgcttgcccgccatgtcggtttgaaggcaggactgtcgattgat
gtgccagctgtgacggtaaaccggttgtgcgggacggggctggagacgatcattatggcg
gcgcgcctcattttaacgggggaagcggaagtgatattggcaggaggcactgaaaacatg
agtcaagtgccgcatgtcattcgtggcatgcgttggggaacacggctaggcagcttgacg
gtggaagattgggtgtgggatgggctatatgatacggtcggcggctgcagcatggctatg
acagctgaaaacttggcgaaagagtatcacattacgcgcgaagaagttgaccaacacgcg
ctccgtagccatgaacgggcgcttgaggctattaaaaaaggatattttcgccaagaaatt
gttcctgtcacggtgcaagagaggaatagggaaacgatcgttgacaccgatgagcacccg
cgccaaacaagcttggagcagttaagggcgcttcacccgcgctttcttgaaaacggagtc
gtgacgccaggcaatgccagcgggataaatgacggggcggcggcggtcattattgcctcg
ggggactatgccgcgaagcgcggcttgaaaccactcgcccgcctcgtttcgtggggagtt
gtcggtgttgaaccaaagtacatggggatcggcccggtcccagcaatccgtcaagcgctg
aaaaatgcgaaattgtcaatcgatgaccttgacttgatcgagatcaatgaggcgttttca
gcccaatatttagcatgccaaaaagaattggggtttgacgacgagaaaggcaatgtcaac
ggcggagccgttgcccttggccatccgttggcggcttcgggaacgcgcattaccttgacg
ctgatttatgagttggcaagaagaaaaaagaaatacggcgtttcttctctatgcatcggc
ggcgggcaagggattgcggcggtttgggagagattgtaa

DBGET integrated database retrieval system