KEGG   Anoxybacillus sp. B7M1: GFC29_2791Help
Entry
GFC29_2791        CDS       T04426                                 

Gene name
metG
Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
anl  Anoxybacillus sp. B7M1
Pathway
anl00450  Selenocompound metabolism
anl00970  Aminoacyl-tRNA biosynthesis
anl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:anl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    GFC29_2791 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    GFC29_2791 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:anl01007]
    GFC29_2791 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:anl03016]
    GFC29_2791 (metG)
Enzymes [BR:anl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     GFC29_2791 (metG)
Amino acid related enzymes [BR:anl01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   GFC29_2791 (metG)
Transfer RNA biogenesis [BR:anl03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    GFC29_2791 (metG)
 Prokaryotic type
   Other AARSs
    GFC29_2791 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f tRNA-synt_1c DUF2383 DNA_ligase_ZBD zinc-ribbons_6 Zn-ribbon_8
Motif
Other DBs
NCBI-ProteinID: ANB63822
UniProt: A0A160FB57
Position
2840693..2842645
Genome map
AA seq 650 aa AA seqDB search
MEKKTFYLTTPIYYPSGKLHIGHAYTTVAGDAMARYKRLRGYDVMYLTGTDEHGQKIQRK
AEEKGVTPQAYVDEIVAGIQELWKKLDISYDDFIRTTEDRHKEVVEKIFARLVEQGDIYL
DQYEGWYCTPCESFYTERQLVDGNCPDCGRPVEKVKEESYFFNMSKYVDRLLQYYEENPE
FIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGDPKHVIYVWIDALSNYITALGY
GTENDEKFLKYWPADVHLVGKEIVRFHTIYWPIMLMALDLPLPKKVFAHGWLLMKDGKMS
KSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINYDLANDLGNLLNR
TIAMIQKYFDGVIPVYDGPKTAFDNQLVETSKETVKHYEEAMEKMEFSVALTALWQFISR
ANKYIDETQPWILAKEEANKEKLASVMTHLAESLRHMAILLQPFLTRTPDKIFQQLGIKQ
QELKEWESLYQFGLLKEGTKVEKGEPLFPRLEMETEVAYIKSHMQGDQAAQNPSANDPSK
ETAAEITIDDFMKVDLRVAQILHAEPVKKANKLLKLQLDLGYEKRQVVSGIAEFYQPEQL
IGKKVICVTNLKPVKLRGELSQGMILAGETNGMLSLATVDENLPNGTKIK
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggagaagaaaaccttttatctgacgacaccgatttactatccaagcggcaagttacat
attggccatgcttatacgacggtggctggagatgcgatggctcgatataagcggcttcgc
ggatacgatgtgatgtatttgacaggaacggacgaacacggacaaaaaattcagcgaaaa
gcggaagaaaaaggagttacacctcaagcatatgtagatgaaatcgttgctgggattcaa
gagctatggaaaaagctcgatatttcttatgatgatttcattcgtacgacagaggatcgc
cacaaagaggtggttgaaaagatttttgcccgcctagtagaacaaggagatatttattta
gatcaatatgaaggctggtattgtacaccttgtgaatcattttatacagaaagacagttg
gtagatggtaattgtccagattgcgggcgtccggttgaaaaggtaaaagaagaatcgtat
ttctttaatatgagcaaatatgtcgatcgtcttcttcaatattacgaagaaaatccggaa
tttatccagccagaatctcgcaaaaatgaaatgattaacaactttattaagcctggcttg
gaagatttagctgtgtcgcgaacaacctttgactggggcattaaagtgccgggagatccg
aaacatgtgatttatgtatggattgatgcgttatctaattatattacagcattgggctat
ggtacggaaaatgatgagaagtttttgaaatattggccggcagatgttcatctggtaggg
aaagaaattgttcgcttccatacgatttactggccgattatgctaatggcactggattta
ccgttgccgaagaaggtatttgcccatggctggctgctaatgaaagatgggaaaatgtcg
aaatctaaaggaaatgtcgtcgatcctgtgacattaattgaccgttatggtttagatgcg
cttcgctattatttactccgcgaagttccatttggttcagatggggtatttactccggaa
gggtttgtcgaacgaattaattatgatttagccaatgatttaggaaatttactaaatcgt
acgattgcgatgattcaaaaatattttgatggtgtgattccggtttatgatggaccgaaa
accgcgttcgataatcagcttgttgaaacatcgaaggaaacggtaaagcattatgaagag
gcaatggaaaaaatggagttttctgttgctctgacagcgttgtggcaattcatcagccga
gctaataaatatattgacgagacacaaccgtggatattagcgaaagaggaagcaaataag
gaaaaattggcgtccgtcatgacgcacttggcagaatcgctccgtcacatggcgattttg
cttcagccatttttaactcgcactccagacaaaatctttcagcagctcggcatcaaacaa
caagaattaaaagaatgggaaagcttatatcaatttggccttttaaaagaaggaacaaag
gttgaaaaaggagagcctttatttccgagattggagatggaaacggaagtggcgtatatt
aaatcgcacatgcaaggagatcaagcggcacaaaatccttcagcaaacgatccatccaaa
gaaacggcggcggaaattacaattgatgattttatgaaagtagatttgcgagtggcgcaa
attctccatgctgaaccggtaaaaaaagccaacaagcttcttaaactacagctcgacctt
ggctatgaaaagcgtcaagttgtgtcaggaattgctgaattttatcaacctgaacaatta
attggcaaaaaagtgatttgtgtaacgaatttgaagccagttaagttgcgaggagagcta
tctcaaggaatgattttggctggcgagacaaatggaatgctttctttagcaactgttgat
gagaatctgccgaacggaaccaaaattaagtag

DBGET integrated database retrieval system