KEGG   Anoxybacillus sp. B2M1: GFC28_3620Help
Entry
GFC28_3620        CDS       T04370                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
anm  Anoxybacillus sp. B2M1
Pathway
anm00071  Fatty acid degradation
anm00072  Synthesis and degradation of ketone bodies
anm00280  Valine, leucine and isoleucine degradation
anm00310  Lysine degradation
anm00362  Benzoate degradation
anm00380  Tryptophan metabolism
anm00620  Pyruvate metabolism
anm00630  Glyoxylate and dicarboxylate metabolism
anm00640  Propanoate metabolism
anm00650  Butanoate metabolism
anm00900  Terpenoid backbone biosynthesis
anm01100  Metabolic pathways
anm01110  Biosynthesis of secondary metabolites
anm01120  Microbial metabolism in diverse environments
anm01130  Biosynthesis of antibiotics
anm01200  Carbon metabolism
anm01212  Fatty acid metabolism
anm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:anm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    GFC28_3620
   00630 Glyoxylate and dicarboxylate metabolism
    GFC28_3620
   00640 Propanoate metabolism
    GFC28_3620
   00650 Butanoate metabolism
    GFC28_3620
  Lipid metabolism
   00071 Fatty acid degradation
    GFC28_3620
   00072 Synthesis and degradation of ketone bodies
    GFC28_3620
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GFC28_3620
   00310 Lysine degradation
    GFC28_3620
   00380 Tryptophan metabolism
    GFC28_3620
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GFC28_3620
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GFC28_3620
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    GFC28_3620
Enzymes [BR:anm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     GFC28_3620
Exosome [BR:anm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GFC28_3620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD
Motif
Other DBs
NCBI-ProteinID: ANB57743
Position
3637601..3638779
Genome map
AA seq 392 aa AA seqDB search
MRTDIVLVEGARTAFAEFCGSFREISATDLGAIAARGAMKKANVEPEEIDHVVFGNVQQS
SRDAHLLARHVGLKAGLSIDVPAVTVNRLCGTGLETIIMAARLILTGEAEVILAGGTENM
SQVPHVIRGMRWGTRLGSLTVEDWVWDGLYDTVGGCSMAMTAENLAKEYHITREEVDQHA
LRSHERALEAIKKGYFRQEIVPVTVQERNRETIVDTDEHPRQTSLEQLRALHPRFLENGV
VTPGNASGINDGAAAVIIASGDYAAKRGLKPLARLVSWGVVGVEPKYMGIGPVPAIRQAL
KNAKLSIDDLDLIEINEAFSAQYLACQKELGFDDEKGNVNGGAVALGHPLAASGTRITLT
LIYELARRKKKYGVSSLCIGGGQGIAAVWERL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcggacagacattgtattggttgaaggagcgcgcacggcgttcgccgaattttgtggt
tcgtttcgcgagatttctgcaaccgatctcggggccatcgcggcgaggggggcgatgaaa
aaggcgaacgtcgaaccggaagaaatcgatcatgtcgtgtttggcaacgttcaacaatca
agccgggatgctcatttgcttgcccgccatgtcggtttgaaggcaggactgtcgattgat
gtgccagctgtgacggtaaaccggttgtgcgggacggggctggagacgatcattatggcg
gcgcgcctcattttaacgggggaagcggaagtgatattggcaggaggcactgaaaacatg
agtcaagtgccgcatgtcattcgtggcatgcgttggggaacacggctaggcagcttgacg
gtggaagattgggtgtgggatgggctatatgatacggtcggcggctgcagcatggctatg
acagctgaaaacttggcgaaagagtatcacattacgcgcgaagaagttgaccaacacgcg
ctccgtagccatgaacgggcgcttgaggctattaaaaaaggatattttcgccaagaaatt
gttcctgtcacggtgcaagagaggaatagggaaacgatcgttgacaccgatgagcacccg
cgccaaacaagcttggagcagttaagggcgcttcacccgcgctttcttgaaaacggagtc
gtgacgccaggcaatgccagcgggataaatgacggggcggcggcggtcattattgcctcg
ggggactatgccgcgaagcgcggcttgaaaccactcgcccgcctcgtttcgtggggagtt
gtcggtgttgaaccaaagtacatggggatcggcccggtcccagcaatccgtcaagcgctg
aaaaatgcgaaattgtcaatcgatgaccttgacttgatcgagatcaatgaggcgttttca
gcccaatatttagcatgccaaaaagaattggggtttgacgacgagaaaggcaatgtcaac
ggcggagccgttgcccttggccatccgttggcggcttcgggaacgcgcattaccttgacg
ctgatttatgagttggcaagaagaaaaaagaaatacggcgtttcttctctatgcatcggc
ggcgggcaagggattgcggcggtttgggagagattgtaa

DBGET integrated database retrieval system