KEGG   Anoxybacillus sp. B2M1: GFC28_396Help
Entry
GFC28_396         CDS       T04370                                 

Definition
(GenBank) mannitol dehydrogenase Rossmann domain protein
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
anm  Anoxybacillus sp. B2M1
Pathway
anm00051  Fructose and mannose metabolism
anm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:anm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    GFC28_396
Enzymes [BR:anm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     GFC28_396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N Polysacc_synt_2 TrkA_N UDPG_MGDP_dh_N Sacchrp_dh_NADP UPF0052 ApbA F420_oxidored NAD_binding_2 NAD_binding_10 Methyltransf_23
Motif
Other DBs
NCBI-ProteinID: ANB58634
Position
387441..388595
Genome map
AA seq 384 aa AA seqDB search
MLAVHFGAGNIGRGFIGQLLSQSGYEVVFVDVNEEIVQKLQEKRHYRVIIAGEQIEEQHV
YHVTALHSVKDHEAVLQHIAKADFVTTAVGPNVLPLIAPVIAEGIRKRLEVNRTPVYIIA
CENMIGGSSFLKEHVWKKLSEEEQTMASQYCSFPNCAVDRIVPNQKNEDLLSVTVEPFFE
WVIETKQMIGTIPPIEGVRIVDELPPYIERKLFTVNTGHALVAYLGYYKKFFTIHEAMKD
EEIYADVVKALNESGRVLIQKYGWNADEHQIYIKKIVQRFTKSAITDEVTRVGRSPIRKL
GPNDRLISPAKQYYDLFHEIPSGLVKGIAALLQFDYQEDTEAMELQETIRQMGIEGALSR
YAGLELGHPLIAAVKTEAATLAKQ
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
gtgttagccgttcattttggtgctggaaatatcggcagaggttttattggccaactactt
tcgcaatcgggctatgaagtcgtatttgtggatgttaacgaggaaattgttcaaaagctg
caagaaaagcggcactatcgggtcattattgccggcgaacaaattgaagagcaacacgtt
taccatgtgacagcactgcacagtgtaaaggatcacgaagctgtgcttcagcacatcgcg
aaagcagatttcgttacgacagctgtcgggccgaatgtattgccgctgattgctcctgtg
atcgctgaagggattcgcaagcgcttagaggtgaatcgaactcctgtttatatcattgct
tgtgaaaatatgattggcggcagcagctttttaaaagagcatgtatggaaaaaattatcc
gaagaagagcaaacaatggccagccaatattgcagtttcccgaactgtgccgttgaccgc
atcgttccaaatcaaaaaaatgaggacttgctttctgttacggtggagccattttttgag
tgggtcattgaaacgaagcaaatgatcggaaccattccgccaattgaaggagtacgcatc
gtcgatgaattgcctccttatattgaaagaaaattgtttaccgtgaatacagggcatgcc
cttgtcgcttatttaggctattacaaaaagtttttcacgattcatgaggcaatgaaggac
gaagagatttatgctgacgtggtgaaggcgctcaatgaatctggacgagtactcattcaa
aagtatggatggaatgctgatgaacatcaaatatatatcaaaaaaattgttcaaagattc
acaaaatctgcgattacggatgaggtgacgagagtagggcgctcgccgattcgcaagctt
ggtccgaacgatcgtctcatcagccctgccaaacaatattatgacttgtttcatgagatc
ccatcagggctcgtcaaaggaatcgccgctctcttgcaatttgattatcaagaagatacc
gaagcgatggagttgcaagagacgattcgacaaatgggcatcgaaggggcgttgtcccgc
tacgcaggattagagcttgggcatccgttgatagcggctgttaagacagaagcggctaca
ttagcgaagcaataa

DBGET integrated database retrieval system