KEGG   Acinetobacter nosocomialis: RR32_03165Help
Entry
RR32_03165        CDS       T04196                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ano  Acinetobacter nosocomialis
Pathway
ano00071  Fatty acid degradation
ano00072  Synthesis and degradation of ketone bodies
ano00280  Valine, leucine and isoleucine degradation
ano00310  Lysine degradation
ano00362  Benzoate degradation
ano00380  Tryptophan metabolism
ano00620  Pyruvate metabolism
ano00630  Glyoxylate and dicarboxylate metabolism
ano00640  Propanoate metabolism
ano00650  Butanoate metabolism
ano00900  Terpenoid backbone biosynthesis
ano01100  Metabolic pathways
ano01110  Biosynthesis of secondary metabolites
ano01120  Microbial metabolism in diverse environments
ano01130  Biosynthesis of antibiotics
ano01200  Carbon metabolism
ano01212  Fatty acid metabolism
ano02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ano00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RR32_03165
   00630 Glyoxylate and dicarboxylate metabolism
    RR32_03165
   00640 Propanoate metabolism
    RR32_03165
   00650 Butanoate metabolism
    RR32_03165
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RR32_03165
   00072 Synthesis and degradation of ketone bodies
    RR32_03165
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RR32_03165
   00310 Lysine degradation
    RR32_03165
   00380 Tryptophan metabolism
    RR32_03165
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RR32_03165
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RR32_03165
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RR32_03165
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ano04147]
    RR32_03165
Enzymes [BR:ano01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RR32_03165
Exosome [BR:ano04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RR32_03165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Tex_N
Motif
Other DBs
NCBI-ProteinID: AJB47163
Position
complement(655513..656688)
Genome map
AA seq 391 aa AA seqDB search
MTDIVIVNGARTAMGGFQGSLSGLTAPELGAVTIKEAIARAGLQPTDVEEVIMGCVLPAG
LKQGPARQAMRKAGLPDSTGAVTINKLCGSGMKAVMQAADMIKAGSAEIVVAGGMESMTN
APYVLPKARAGYRMGHGEIKDHMFFDGLEDAETGRLMGSFAQDMANTRGYTREQMDDFAI
RSLKRAQTAITEGYFKDEIVPVTVSTRKGDVIVDQDEQPLNAKIDKIPSLKPAFAKDGTI
TAANASSISDGASALVLTSSEVAAQRGLQPLAKIIATASNSQHPSEFTIAPVGAIEKVLK
KAGWNAQDVDLWEINEAFAMVTMCPIDDFKLDAEKVNINGGACALGHPVGSTGSRIILTL
IHALKRTGGKKGIAALCIGGGEATAVAIEIL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgactgacatcgtaattgttaatggtgctcgtactgctatgggtggttttcaaggatca
ctatctggtctaactgctcctgaactaggtgcagtaacaattaaagaagcaatcgcacga
gcaggcttgcaacctactgatgtcgaagaagtcattatgggttgtgtactacctgcgggt
ttaaaacaaggccctgctcgtcaagcgatgcgtaaagctggtttacctgactctacaggt
gcagtgacgattaataagctttgtgggtcaggcatgaaagccgtgatgcaagcagcagac
atgatcaaagcaggcagtgctgaaattgtggttgcaggtggcatggagtcaatgactaat
gctccttatgtattgcccaaagcacgtgctggttaccgtatgggtcatggcgaaattaaa
gaccatatgttcttcgacggtttagaagatgctgaaacgggtcgtttaatgggttcattt
gctcaagatatggcaaatacacgtggctatacacgtgagcaaatggatgactttgccatt
cgttctttaaaacgtgctcaaactgcaattactgaaggctatttcaaagatgaaatcgtc
cctgttactgtctctacacgtaaaggcgatgtcattgttgaccaagatgaacaaccttta
aatgcgaagattgataaaattccttcacttaaaccagcttttgcaaaagacggtacaatt
accgcagcaaatgcgagttctatttctgatggtgcttctgcattggtgttaacatcaagt
gaagttgcagcacaacgtggcttacaaccgcttgctaaaattattgcgacagcttcaaat
tctcagcatccatcagaatttaccatcgctcctgtgggtgctatcgagaaagttcttaaa
aaagctggatggaatgctcaggacgttgacctttgggaaattaatgaagcatttgctatg
gttaccatgtgcccaattgatgatttcaaacttgatgcagagaaagtgaatatcaatggt
ggtgcttgtgccctaggtcatccggtaggttctacaggttctcgcattattcttacactt
attcatgcgcttaaacgtactggcggcaaaaaaggtattgccgcactttgtattggtggt
ggtgaagcaacagctgttgccatcgaaattctttaa

DBGET integrated database retrieval system