KEGG   Acinetobacter nosocomialis: RR32_07480Help
Entry
RR32_07480        CDS       T04196                                 

Definition
(GenBank) ornithine cyclodeaminase
  KO
K21721  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase [EC:1.5.1.51]
Organism
ano  Acinetobacter nosocomialis
Pathway
ano00998  Biosynthesis of secondary metabolites - other antibiotics
ano00999  Biosynthesis of secondary metabolites - unclassified
ano01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ano00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of secondary metabolites - other antibiotics
    RR32_07480
   00999 Biosynthesis of secondary metabolites - unclassified
    RR32_07480
Enzymes [BR:ano01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.51  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase
     RR32_07480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OCD_Mu_crystall Shikimate_DH AlaDh_PNT_C F420_oxidored GFO_IDH_MocA NAD_binding_7 TrkA_N
Motif
Other DBs
NCBI-ProteinID: AJB47955
Position
complement(1579045..1580058)
Genome map
AA seq 337 aa AA seqDB search
MSNLATLRYLSQSDLLNLGANHSNSFIEAITEGLTLHANKQFVQPLKPYLRWQGADHIAD
RIIAMPCYLGGNDPIAGIKWIGSRQHNPKKFNIPRASALIVLNDSETNYPVAVMEGSLIS
AMRTAAITGVSIKYLAKKDFSDITVIGCGPIAQMQIKTVLEQYAQVKKIHLFDVNPEAAE
KLKALFLSEYPNLEIEIHDSAKSAIVQADVLITCTVSDKPYIPFDWLKKGCFVSNISIMD
IEPEVFLKVDKVIVDDWDQSNREKKVINVLVEDGLFSREKLHAELGDIIIGHKNGREHED
EIILLNPMGMAIDDIVCAKWFFNAAQEQNVGTVLPLL
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatttggctacccttcgctatttaagtcaatcagatttattaaatcttggcgca
aatcatagtaattcatttattgaagcaattactgaaggtttaaccctgcatgcaaataaa
cagtttgtacaacctttaaaaccttatcttcgctggcaaggtgcagaccatattgcggac
cgtattattgcaatgccttgctatttaggtggcaacgacccgattgccggaatcaaatgg
attggttcaagacaacataaccctaaaaaattcaatattccgcgtgccagcgcactgatt
gttttaaatgattcagaaacaaattatccggttgcagtgatggaaggcagcctcatcagt
gccatgcgaactgcggcaattacgggtgtttctattaagtatttagcgaaaaaggacttt
tcagacattaccgtaattggctgcggtccaattgctcaaatgcagattaagacggtactt
gagcaatacgctcaagtgaaaaaaatacatttatttgatgtaaaccctgaagcggctgaa
aaactcaaagcattgttcttatcagaatatccaaatctagaaattgaaattcatgacagc
gccaagtctgcaattgtgcaagccgatgtcctcattacctgcacagtttcagataagcct
tacattccgtttgattggcttaaaaaaggctgctttgtttcaaacatttcaattatggat
attgagcctgaagtcttcttaaaagtagacaaagtgattgtagatgactgggatcaatca
aaccgagaaaagaaagtcatcaacgtgttggttgaagatggtctattcagccgtgaaaaa
ctgcatgctgaacttggcgacatcattattggtcataaaaacggccgcgaacacgaagat
gaaatcattttgctcaacccaatgggcatggcgattgacgatattgtctgcgctaaatgg
ttcttcaatgctgcacaagaacagaacgttggtacggttctaccgcttttataa

DBGET integrated database retrieval system