KEGG   Acinetobacter nosocomialis: RR32_10585Help
Entry
RR32_10585        CDS       T04196                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ano  Acinetobacter nosocomialis
Pathway
ano00480  Glutathione metabolism
ano00590  Arachidonic acid metabolism
ano01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ano00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    RR32_10585
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RR32_10585
Enzymes [BR:ano01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     RR32_10585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin DUF4174
Motif
Other DBs
NCBI-ProteinID: AJB48542
Position
complement(2225682..2226167)
Genome map
AA seq 161 aa AA seqDB search
MSNIYQFEAELLEGDIKQFADYKGKVLLIVNTASKCGFTPQFAGLEKLYEKYKDQGLEVL
GFPCNQFGGQDPGNNKEIGAFCQRNYGVKFPMFAKVDVKGPEAHVIFRYLTREAKGILGS
SSIKWNFTKFLVGKDGSVLNRYAPTTKPEALEADIEKALAG
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacatttatcagtttgaagctgaattgttagaaggtgatattaagcaatttgct
gattacaaaggtaaagttttattaattgtaaatactgccagtaaatgtggttttactcca
cagtttgcgggcctcgaaaaactttatgaaaaatataaagatcaaggtttggaagtttta
ggttttccctgcaaccagtttggtgggcaagatccaggaaataataaagaaatcggggct
ttctgccagcgaaattatggggtgaaattccctatgtttgccaaagtcgatgtgaaaggg
cctgaagctcatgtgatttttagatatttaacacgtgaagcaaaaggaattttgggaagt
agtagtattaaatggaactttaccaaatttttggttggcaaagatggttcagttttaaat
cgttatgcacctacaactaaaccagaggcattggaagccgatattgaaaaagcattagcg
ggctaa

DBGET integrated database retrieval system