KEGG   Antarcticibacterium sp. PAMC 28998: FK178_07420Help
Entry
FK178_07420       CDS       T06142                                 

Gene name
hemL
Definition
(GenBank) glutamate-1-semialdehyde-2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
anp  Antarcticibacterium sp. PAMC 28998
Pathway
anp00860  Porphyrin and chlorophyll metabolism
anp01100  Metabolic pathways
anp01110  Biosynthesis of secondary metabolites
anp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:anp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FK178_07420 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:anp01007]
    FK178_07420 (hemL)
Enzymes [BR:anp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     FK178_07420 (hemL)
Amino acid related enzymes [BR:anp01007]
 Aminotransferase (transaminase)
  Class III
   FK178_07420 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: QED37565
UniProt: A0A5B8YIJ1
Position
complement(1649728..1651014)
Genome map
AA seq 428 aa AA seqDB search
MTYKRSSELFAEAQKVIPGGVNSPVRAFNAVGGDPVFIERAEGAYLYDVDGNRYIDYINS
WGPMILGHAYKPVVDAVIEKAKLGTSFGTPTEIETRIAELAVKLVPNIDKIRMVNSGTEA
CMSAVRLARGFTKREKIIKFAGCYHGHSDSFLIQAGSGAVTFGTPNSPGVTQGTAKDTLL
AIFNDIDSVRKLVEANTGEIACIILEPVAGNMGCIPPRDGFLSGLRRLCDENEILLIFDE
VMTGFRLAPGGVQERFGINADIVTFGKVIGGGLPVGAFAARAEIMDMLAPIGPVYQAGTL
SGNPLAMAAGLAMLTELDQNREIFKSIDEKTAYLHKGIQAALNSYNIPHTINRLGSMISV
HFCEGEVSNFETAAHGNNHTFKQFFHGMLDNGIYIAPSAFETWFITEALSYEDLDATIEA
VKIVAKYL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgacttataaaagaagtagtgagctttttgctgaagctcaaaaagtaattcccgggggc
gtaaattctccggtaagggcgtttaatgcagttggcggggatcccgtttttattgaacgg
gcagaaggcgcttatttatatgatgtagacgggaatagatatatagattacattaattcc
tggggacccatgatccttgggcacgcttataaacctgttgtagatgccgttattgaaaag
gcgaaattaggaacatcctttggaacacctaccgagattgaaacgaggatcgcagaactt
gccgtgaaattggttcctaatatagataagataagaatggtaaattcaggcacagaggcc
tgtatgagtgctgtaaggcttgcacgcggattcacaaaacgggagaagatcataaaattc
gccggttgctatcacggccacagcgattcttttttgatccaggccggcagtggcgctgtt
acctttggaactccgaacagccccggggtaacccaggggacggccaaagataccttactg
gccatatttaatgacattgacagcgtgcgaaaactggtagaggctaatacaggggagatc
gcctgtataatcctggagcctgttgcagggaacatgggatgtatacctccacgggacggt
ttcttatctggcctgcgcaggttatgcgatgaaaatgaaattctgttgatatttgatgag
gtaatgaccggcttccggcttgcccctggcggggttcaggaaagattcgggataaatgca
gatattgtaacttttgggaaggttataggagggggtcttcctgtgggagcttttgctgcc
cgggcagagatcatggatatgctggcgccaattggccctgtatatcaggccggtactctt
agtgggaaccccctggcaatggctgccggattggctatgctaaccgaacttgaccaaaac
cgcgagatctttaaaagtatagatgaaaaaaccgcttacctgcataaaggtatacaggca
gctttgaattcctacaacattccgcatacaattaatagattgggatctatgatatctgtg
catttttgtgaaggagaagtaagcaattttgagacggctgcccatgggaataatcacacc
tttaaacagttcttccatggaatgctggataacgggatttatattgcgcccagtgccttt
gaaacctggtttattactgaagctttatcctatgaagaccttgacgccactatagaagcg
gtaaaaatagtagcaaaatacctgtaa

DBGET integrated database retrieval system