KEGG   Arsenophonus nasoniae: ArsFIN_05660Help
Entry
ArsFIN_05660      CDS       T05992                                 

Gene name
apaG
Definition
(GenBank) Protein ApaG
  KO
K06195  ApaG protein
Organism
ans  Arsenophonus nasoniae
Brite
KEGG Orthology (KO) [BR:ans00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    ArsFIN_05660 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: QBY42033
UniProt: D2U2B0
Position
complement(571712..572089)
Genome map
AA seq 125 aa AA seqDB search
MLNEPNICIQVQSVYIENQSLPEEARFVFAYTISISNLGRTPVQLISRYWLITNSDGKRT
EVQGQGVVGEQPIIQPGAEYRYTSGAIIETPMGTMEGHYVMLDNDGKNFYVDIPVFRLAI
PTLIN
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgctaaatgaaccaaacatctgcatacaagttcaaagtgtctatattgaaaatcaatct
ttaccagaagaagcccggtttgtttttgcctatacaatttctattagcaatcttggccgt
acaccggtacaactaataagtcgctattggttaattaccaatagtgatggtaaacgtacc
gaagtacaaggccagggtgtcgtaggagaacaacctatcattcaacccggcgccgaatat
cgttataccagtggcgctattatagaaacgccaatgggaactatggaaggccattatgta
atgttagataatgatggtaaaaatttttatgttgatatcccagtttttcgtcttgctatt
ccaacacttataaactaa

DBGET integrated database retrieval system