KEGG   Arsenophonus nasoniae: ArsFIN_14380Help
Entry
ArsFIN_14380      CDS       T05992                                 

Gene name
agp_1
Definition
(GenBank) Glucose-1-phosphatase
  KO
K01085  glucose-1-phosphatase [EC:3.1.3.10]
Organism
ans  Arsenophonus nasoniae
Pathway
ans00010  Glycolysis / Gluconeogenesis
ans01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ans00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ArsFIN_14380 (agp_1)
Enzymes [BR:ans01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     ArsFIN_14380 (agp_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_2 DNA_pol_A_exoN
Motif
Other DBs
NCBI-ProteinID: QBY42877
UniProt: D2TVS0
Position
1386899..1387807
Genome map
AA seq 302 aa AA seqDB search
MRAPIIYENILTRATNKAWPIWHTNNGNLTTKGRQLEIYLGNYFRSWFDRMGLLRQDKCP
DSNNVYVYANNQQRTIATAESFITGAFPDCLVKTFYRSDMNDGEFDTIFATVITDDSAEF
KRQAESAMAEKLAYLDLAEAYKQVSTILDFKNSTLCKKDKLCDLVSYPNTMNISAGKEPF
VFGPLGLAANVVDVFDLQYYEGFATKDVAWGTISTPEQWKTLNKIRNGYHAVAYKTKIVA
SNIAKPLLEYIDLYFVQPRKIAGSKLLIMFGHDSNIASVMSALDFAPYQLSEQYEKTQLV
GN
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgagagcaccaatcatatatgaaaatatattaactcgtgcaacgaataaagcttggcct
atttggcatacaaacaatggaaatcttacgactaaaggtcgccaattagagatttattta
ggaaactactttagatcatggtttgatagaatggggctattgcgtcaagataaatgtcca
gattcaaataatgtctatgtatatgcaaacaatcaacaacgtactattgctacagcagaa
tcttttattacaggcgcttttcctgattgcttggttaaaactttttatcgttcagatatg
aatgacggagagtttgatactatttttgctacagttatcactgatgatagtgcagaattt
aagcgacaagccgaaagcgctatggcagaaaaattagcatatttggatttagctgaagct
tataaacaagtgtcaacaatattggattttaagaattcaacgctatgtaaaaaagataaa
ttgtgtgatcttgttagctatccaaacacaatgaatattagtgcaggtaaagaacccttt
gtgtttggtccattaggattagcagcgaacgttgtagatgtatttgatcttcagtattac
gaaggatttgctaccaaagatgttgcttggggaacaattagtacaccagagcaatggaaa
acacttaataaaattagaaatggctatcatgcagttgcatataaaactaaaatagttgct
agtaacatagctaaacctttattagaatatattgatttgtattttgttcaaccacgcaaa
attgcaggttcaaaattacttattatgtttggtcatgattcaaatatcgcgtcagtaatg
tctgctctggatttcgccccttatcaattatctgaacaatatgaaaaaacccaattggtg
ggaaattag

DBGET integrated database retrieval system