KEGG   Arsenophonus nasoniae: ArsFIN_18440Help
Entry
ArsFIN_18440      CDS       T05992                                 

Gene name
zwf
Definition
(GenBank) Glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
ans  Arsenophonus nasoniae
Pathway
ans00030  Pentose phosphate pathway
ans00480  Glutathione metabolism
ans01100  Metabolic pathways
ans01110  Biosynthesis of secondary metabolites
ans01120  Microbial metabolism in diverse environments
ans01130  Biosynthesis of antibiotics
ans01200  Carbon metabolism
Module
ans_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ans_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:ans00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ArsFIN_18440 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ArsFIN_18440 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ans04147]
    ArsFIN_18440 (zwf)
Enzymes [BR:ans01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     ArsFIN_18440 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     ArsFIN_18440 (zwf)
Exosome [BR:ans04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   ArsFIN_18440 (zwf)
  Exosomal proteins of colorectal cancer cells
   ArsFIN_18440 (zwf)
  Exosomal proteins of bladder cancer cells
   ArsFIN_18440 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: QBY43277
UniProt: D2TXX5
Position
1737889..1739364
Genome map
AA seq 491 aa AA seqDB search
MAINKAVQACNLIIFGAKGDLARRKLLPSLYQLEKTGYIHPDTRIIGIGRAEWDAAAYMK
EVREALKTFLNEKIEPDLWQKLSERLDFFNLDVQDLNKFNSLAKYLEGDSKPAIYYFAMP
PTTFGAVCHGLGHACLNKKPNRVVMEKPLGSDLASSQEINNEVAKYFKESQIYRIDHYLG
KETVLNLLALRFANSLFINNWDYRAIDHVQITVAEEVGIEGRWGYFDQAGQMRDMVQNHL
LQILTMIAMSPPAELTADRIRDEKVKVLRSLRRIDYSNVREKTVRGQYTSGSVQGKKVAG
YLAEEGANTSSKTETFVAIRVDIDDWRWASVPFYLRTGKRLAAKCSEVVVYFKKPALNIF
SDSYQDLPQNKLTIRLQPDEGIDIEILNKAPGLEHKHHLQTTKLDLSFSETFNQIHLADA
YERLLLEAMRGIQALFVRRDEVEEAWKWVDSIMEAWAKDNEPPKPYQAGTWGPDASDVMI
TKDGRSWNAFE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggcgattaataaagctgtccaggcatgtaatttaattattttcggcgcaaaaggagat
ttggctcgccgcaaattattgccttccctttatcaattggaaaaaacgggttatatccat
cctgatacacgtattataggtattggccgagctgaatgggatgctgccgcctatatgaag
gaagttagagaagcgttaaaaacttttttaaatgagaaaattgagcctgatttatggcaa
aaattaagtgagcgtcttgatttttttaatttagatgttcaggatttgaacaaatttaat
tcattagctaaatatcttgaaggcgatagcaaaccagctatatattattttgctatgcca
ccaacgacttttggtgctgtttgtcatggtttaggccatgcctgccttaataaaaagcct
aatcgggttgttatggagaaaccattaggcagcgatcttgcatcttcccaagaaataaat
aatgaagttgctaagtattttaaagagagccaaatttatcgtattgatcactatttaggt
aaagaaacagtactcaatttattagcattacgttttgccaactctttatttattaataat
tgggattatcgagcgattgatcatgtccagatcacggttgctgaagaagttggtatcgaa
ggacgttggggttattttgatcaggctgggcagatgcgtgacatggttcaaaatcattta
ttacaaatcctgacgatgattgctatgtcaccgcctgcggaattaactgcagatcgtata
cgggatgagaaagttaaagtattgcgttcattacgacgcattgattatagtaatgtgcgt
gaaaaaaccgtacgaggtcaatatacatcaggttctgttcaaggtaaaaaagtagccggc
tatcttgcagaggaaggtgcaaatacatcaagtaaaaccgaaacttttgtggccattcgg
gttgatatagatgattggcggtgggcgagtgtaccattttatttaagaacaggcaaacgg
ttagcggcaaaatgttctgaagtagtggtttattttaaaaaaccggcgttaaatattttt
tctgattcttatcaggatctaccacaaaataaattaactattcggttacagcctgatgaa
ggaatagatatagaaattttaaataaagcgccggggcttgagcataaacatcatttacag
acgacaaaattagatctgagtttttctgaaacatttaatcaaatccacttggctgatgca
tatgaacgcttattactagaagctatgcggggcatccaagcactgtttgtccgtcgagat
gaagtagaggaagcatggaaatgggtagattctattatggaagcttgggcaaaggataat
gaaccgcctaaaccctatcaagctggtacatggggaccggatgcttctgatgtgatgatc
accaaagatggccgctcatggaatgcgtttgaatag

DBGET integrated database retrieval system