KEGG   Arsenophonus nasoniae: ArsFIN_40230Help
Entry
ArsFIN_40230      CDS       T05992                                 

Gene name
mqo_1
Definition
(GenBank) Malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
ans  Arsenophonus nasoniae
Pathway
ans00020  Citrate cycle (TCA cycle)
ans00620  Pyruvate metabolism
ans01100  Metabolic pathways
ans01110  Biosynthesis of secondary metabolites
ans01120  Microbial metabolism in diverse environments
ans01130  Biosynthesis of antibiotics
ans01200  Carbon metabolism
Module
ans_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ans_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ans00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ArsFIN_40230 (mqo_1)
   00620 Pyruvate metabolism
    ArsFIN_40230 (mqo_1)
Enzymes [BR:ans01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     ArsFIN_40230 (mqo_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo NAD_binding_8 DAO DUF3792 Thi4 Lipase_GDSL_3 Shikimate_DH FA_desaturase Adeno_E3_CR2
Motif
Other DBs
NCBI-ProteinID: QBY45424
UniProt: A0A4P7L592
Position
3710017..3710334
Genome map
AA seq 105 aa AA seqDB search
MKRSLKYTAVIIGLLIIILLIYLFRPTASYPIKTSINEPTVNIVLIGAGIMSATLATYLA
ELQPDWQIRMYERLDSIAGDTSNGWNNAGTGHSGFMEMNISTPLA
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgaagagatcattaaaatatacagctgtgattattggtttattaataattattttatta
atttatttatttaggccgacagcttcatacccgatcaaaacttcaatcaatgaacctact
gttaatattgtacttatcggcgctgggatcatgagtgctacattagcgacatacttagca
gaattgcaaccagattggcaaattcgcatgtatgagcgactagacagtattgccggtgac
acctctaatggctggaataatgccggtaccggtcattcaggctttatggaaatgaacata
agcacgcctttggcgtga

DBGET integrated database retrieval system