KEGG   Arcobacter nitrofigilis: Arnit_0284Help
Entry
Arnit_0284        CDS       T01235                                 

Definition
(GenBank) thiamine pyrophosphate protein domain protein TPP-binding protein
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
ant  Arcobacter nitrofigilis
Pathway
ant00010  Glycolysis / Gluconeogenesis
ant00020  Citrate cycle (TCA cycle)
ant00620  Pyruvate metabolism
ant00633  Nitrotoluene degradation
ant00640  Propanoate metabolism
ant00650  Butanoate metabolism
ant00680  Methane metabolism
ant01100  Metabolic pathways
ant01120  Microbial metabolism in diverse environments
ant01130  Biosynthesis of antibiotics
ant01200  Carbon metabolism
Module
ant_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ant00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arnit_0284
   00020 Citrate cycle (TCA cycle)
    Arnit_0284
   00620 Pyruvate metabolism
    Arnit_0284
   00640 Propanoate metabolism
    Arnit_0284
   00650 Butanoate metabolism
    Arnit_0284
  Energy metabolism
   00680 Methane metabolism
    Arnit_0284
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Arnit_0284
Enzymes [BR:ant01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Arnit_0284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: ADG91950
UniProt: D5V4Y8
Position
complement(271966..272922)
Genome map
AA seq 318 aa AA seqDB search
MSNQKVIKNLKTFSTAAERFEGSHVLCPGCAHSIIVREVLNATNDNLVVSAATGCLEVCT
AIYPHTSWDCSWIHIGFENASTAIAGAETMNKVLRKKGRIDPSTPEPKFVTFGGDGATYD
IGFQWISGCFERGHDFMYICLDNEVYANTGGQRSSSTPIGSSTTTAPAGSTSYGEKRNKK
DMLAIMAAHGSPYVAQVAPNKWKDMIKKIQTGFDTKGPVFINAMSACTTEWKFQPHETIE
ASDLAVDSLVFPLYEIIDGTELNITYRPKNIVPVRDYLAFQPRFKHLFKPENEYIIEEWQ
KRVDAKWEYLQKREEARV
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatcaaaaagtaatcaaaaacttaaaaacattttcaactgcggctgaaagattt
gagggttctcatgttttatgtccaggttgtgcacactcaattattgtaagagaagtacta
aatgctacaaatgataacttagtagtatcagcagcaactggatgtttagaagtttgtaca
gctatttatccacatacttcatgggactgttcttggattcatataggatttgaaaatgcc
tcaactgcaatcgcaggtgctgagactatgaataaagttctaagaaaaaaaggaagaatc
gatccatcaactcctgaaccaaaatttgtaacatttggtggagatggagcaacttatgat
attggtttccaatggatttcaggatgttttgaaagaggacatgactttatgtatatttgt
ttagacaatgaagtttatgcaaatacaggaggtcaaagatcatcttctactcctattggt
tcaagtacaacaacagcaccagctggaagtacttcttatggtgaaaaaagaaataaaaaa
gatatgctagcaatcatggccgcacacggttcaccatatgtagcacaagttgcaccaaac
aaatggaaagatatgattaaaaagatccaaacaggatttgatacaaaaggacctgtattt
ataaatgcaatgagcgcctgtacaacagagtggaagttccaaccacacgaaacaatagaa
gcctcagatttagcagttgattcgctagttttcccactatacgaaatcatagatggaaca
gaattaaatataacatacagaccaaaaaacatagtgccagtaagagattacctagctttc
caaccaagatttaaacacctgtttaaaccagaaaatgagtatatcatagaagaatggcaa
aaaagagtagatgccaaatgggagtatctacaaaagagagaagaagcaagagtttag

DBGET integrated database retrieval system