KEGG   Arcobacter nitrofigilis: Arnit_0287Help
Entry
Arnit_0287        CDS       T01235                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
ant  Arcobacter nitrofigilis
Pathway
ant00010  Glycolysis / Gluconeogenesis
ant00020  Citrate cycle (TCA cycle)
ant00620  Pyruvate metabolism
ant00633  Nitrotoluene degradation
ant00640  Propanoate metabolism
ant00650  Butanoate metabolism
ant00680  Methane metabolism
ant01100  Metabolic pathways
ant01120  Microbial metabolism in diverse environments
ant01130  Biosynthesis of antibiotics
ant01200  Carbon metabolism
Module
ant_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ant00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arnit_0287
   00020 Citrate cycle (TCA cycle)
    Arnit_0287
   00620 Pyruvate metabolism
    Arnit_0287
   00640 Propanoate metabolism
    Arnit_0287
   00650 Butanoate metabolism
    Arnit_0287
  Energy metabolism
   00680 Methane metabolism
    Arnit_0287
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Arnit_0287
Enzymes [BR:ant01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Arnit_0287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR Peroxin-22
Motif
Other DBs
NCBI-ProteinID: ADG91953
UniProt: D5V4Z1
Position
complement(274585..275148)
Genome map
AA seq 187 aa AA seqDB search
MLEIRWHSRAGQGAVTGAKGLGSVVAETGKEVQAFAFYGSAKRGASMTAYNRIDDKQIIN
HEKFMEPNFVFILDPALAFTDDFTANETEDTKYIITTHLSKEELIEAIPALHGRENRTFI
LDCLQISQETIGRPIPNTPMLGAFMKVSGMFELDYFQNAMKSVLKKLPQKIIDANMIAIE
RAYNEVH
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaattagatggcacagtagagcaggacaaggggcggttactggtgcaaaaggt
ctaggttcagttgtagcagaaacggggaaagaagttcaagcttttgcattttatggatct
gcaaaaagaggtgcttctatgactgcttataacagaatagatgacaaacaaatcataaac
catgagaaattcatggaaccaaactttgtatttatattagacccagcattagcatttaca
gatgactttacagctaatgaaactgaagatactaaatacataatcacaacacaccttagt
aaagaagagttaatagaagcaattccagctttacatggtagagaaaacagaacatttata
ctagattgtttgcaaatttctcaagaaacaataggaagacctattccaaatacaccaatg
cttggggcatttatgaaagtaagtggtatgtttgaattggattatttccaaaatgcgatg
aaatcagtgcttaaaaaacttcctcaaaagataatcgatgcaaatatgattgctattgag
agagcatacaatgaagtacattaa

DBGET integrated database retrieval system