KEGG   Arcobacter nitrofigilis: Arnit_1014Help
Entry
Arnit_1014        CDS       T01235                                 

Definition
(GenBank) Formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
ant  Arcobacter nitrofigilis
Pathway
ant00670  One carbon pool by folate
ant01100  Metabolic pathways
ant01120  Microbial metabolism in diverse environments
ant01200  Carbon metabolism
Module
ant_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:ant00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Arnit_1014
Enzymes [BR:ant01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     Arnit_1014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA AAA_31 DUF3963
Motif
Other DBs
NCBI-ProteinID: ADG92677
UniProt: D5V395
Position
1000444..1002120
Genome map
AA seq 558 aa AA seqDB search
MSDIEIAQKASMKPIIELAKAKFNIPPEHLDPYGHYKAKLSLEYVDSLSHQNKEGKLILV
TAISPTPAGEGKTTTTVGLGDALNRIGKKTIICLREPSLGPCFGLKGGAAGGGYAQVVPM
EDINLHFTGDFHAIGVAHNLLAAMIDNHIHHGNALNIDSRRIKWKRVLDMNDRALRKITI
GQGGIGNGFLREDGFDIVVASEVMAILCLATNRADLKERLGRIIIGYKTDKITPVYASDL
KAQGAMAAVLKDAIKPNLVQTLENNIAIVHGGPFANIAHGCNSVTATKTALKLADYAVTE
AGFGADLGAEKFLNIKCRSSKLKPSAVVLVATVRALKYHGGIETDHLNQENLEALEIGFS
NIQRHIHNITKNYNLPVVVSINHFTHDTDAETSLLKKKCEELGVKCVISSHWAKGGAGAE
ELAREIIEIVDNKEASFDYLYDDDIPLWNKIEVIATKIYGAKEIVASSKVHEEIDKLQNK
YGKLPICMAKTQMSFSTDPTLKGAPSNHIIEISDVKLENGAGFIVVIAGNMMTMPGLPKV
PTAEKIDIDDDGLITGLF
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatattgaaatagcacaaaaagcttcgatgaagccaattatagaattagcaaaa
gcaaaatttaatattcccccagaacatctcgacccttatggacactataaagcaaaactc
tctttagaatatgttgatagtttaagtcatcaaaataaagagggaaaacttatacttgta
actgccataagtcccactccagcaggggaaggaaaaactactactacagttggtttaggt
gatgctttaaatagaataggtaaaaaaactattatatgtttacgagaaccatctcttggg
ccttgttttggtttaaaaggaggagcagctggtggaggttatgctcaagttgtacctatg
gaagatataaatttacattttactggagattttcatgctattggagtggcgcataattta
cttgcagccatgattgacaatcatattcaccatggcaatgctttaaatatagattcaaga
cgtataaagtggaaacgtgttttggatatgaatgatagagctttacgaaaaataactatt
ggacaaggtggtattggaaatggttttttaagggaagatggctttgatattgttgttgct
tctgaagttatggcaatcctttgtttagctacaaatagagctgatttaaaagagagactt
gggcgaataattattggatataaaactgacaaaatcacacctgtatatgcaagtgattta
aaagctcagggtgccatggcagctgttttaaaagatgctattaaaccaaacttagtacaa
actttagaaaataatattgctatagttcatggtggcccttttgcaaatattgcccatggt
tgtaactctgtaacagctacaaaaacagcgctaaaattagctgattatgcagttacagaa
gctggttttggagcagatttaggagctgaaaagtttttaaatattaaatgcagaagttct
aaactaaaaccctctgctgttgtattagttgcaactgtaagagcactaaagtatcatgga
ggtattgaaactgatcacctaaatcaagaaaatctagaagctcttgaaataggtttttca
aatattcaaagacatattcataatatcaccaaaaattataatcttccagttgttgttagt
ataaatcatttcacccatgatactgatgctgaaacatctcttttaaagaaaaaatgtgaa
gagttaggtgtgaagtgtgttatttcaagtcattgggcaaaaggtggagctggagctgaa
gagttagcacgtgaaataattgaaattgttgataataaagaagctagttttgattattta
tacgatgatgatattcccctttggaataaaattgaagtaattgctacaaaaatatatgga
gcaaaagagatagttgcaagttcaaaagtacatgaagagatagataaacttcaaaataag
tatggaaaactccctatttgtatggcaaaaacacaaatgtctttttccacagatcctact
ttaaaaggagcaccaagtaatcatattatagaaataagtgatgtaaaactagaaaatgga
gcaggctttatagttgtaattgctggaaacatgatgacaatgcctggacttcctaaagtg
ccaactgctgaaaaaatcgatatcgatgatgatggtttaattacagggcttttttag

DBGET integrated database retrieval system