KEGG   Arcobacter nitrofigilis: Arnit_1348Help
Entry
Arnit_1348        CDS       T01235                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ant  Arcobacter nitrofigilis
Pathway
ant00071  Fatty acid degradation
ant00280  Valine, leucine and isoleucine degradation
ant00310  Lysine degradation
ant00362  Benzoate degradation
ant00380  Tryptophan metabolism
ant00620  Pyruvate metabolism
ant00630  Glyoxylate and dicarboxylate metabolism
ant00640  Propanoate metabolism
ant00650  Butanoate metabolism
ant00900  Terpenoid backbone biosynthesis
ant01100  Metabolic pathways
ant01110  Biosynthesis of secondary metabolites
ant01120  Microbial metabolism in diverse environments
ant01130  Biosynthesis of antibiotics
ant01200  Carbon metabolism
ant01212  Fatty acid metabolism
ant02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ant00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Arnit_1348
   00630 Glyoxylate and dicarboxylate metabolism
    Arnit_1348
   00640 Propanoate metabolism
    Arnit_1348
   00650 Butanoate metabolism
    Arnit_1348
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Arnit_1348
   00072 Synthesis and degradation of ketone bodies
    Arnit_1348
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Arnit_1348
   00310 Lysine degradation
    Arnit_1348
   00380 Tryptophan metabolism
    Arnit_1348
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Arnit_1348
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Arnit_1348
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Arnit_1348
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ant04147]
    Arnit_1348
Enzymes [BR:ant01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Arnit_1348
Exosome [BR:ant04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Arnit_1348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADG93006
UniProt: D5V571
Position
complement(1316877..1318148)
Genome map
AA seq 423 aa AA seqDB search
MRERIAIIDGLRSPVAKANGKLNNVSADSLGAIIAKELVLRNNIPYDDFDEVIIGNVAQP
ANAANIARVLAMRAGFPKKTIAYTVHRNCASGMQALSSSIEKIYTKQGKIYLAGGVESMS
NIPLLFSNQFKDFMTKFTYAKSTSEKLKLLTSFRLSFLKPTIGLISGLTDPISGKIMGIT
AENLANEFKISRQAQDEYSLQSHLKAQKAIESGILNDEIHPIMTKDSSIMDDDGIRFNQT
IQALNKLKPIFDRNGTVTAGNSSQVSDGACMMILCSESKAKELGLEPIGFIKDYAYAGLD
ANKMGLGPIFATKKLFDKTGVSLKNIDLIELNEAFAAQVIANLEAFKSKSFCKKEFNSEP
LGEINEEILNVNGGAIAIGHPVGMSGARIVLHTVKELKRKGLKTGLATLCVGGGQGASFL
VEV
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaaagaatagcgataattgatggattaagaagcccagtagcaaaagcaaatggg
aaattaaataatgtaagtgctgatagcttaggtgcaattattgcaaaagagctagttctt
agaaataatataccctatgatgattttgatgaagttattattggaaatgttgcccaacca
gcaaatgcagcaaatatagcaagagttctagctatgagagctggttttcctaaaaaaacc
attgcatatactgttcatagaaattgtgcttcaggtatgcaagccctatcaagctcaatt
gaaaaaatatatacaaaacaagggaaaatatatctggccggtggagttgaatccatgagt
aatattcccctactcttttcaaaccaatttaaagattttatgacaaaatttacctatgca
aaaagtacatctgaaaaactaaaattacttacaagttttcggcttagttttttaaaacct
actattggattaatttctggattaacagacccaatttctggaaaaatcatgggaataact
gctgaaaatcttgcaaatgagtttaaaataagtcgccaagcccaagatgaatattcacta
caatcacatctaaaagcacaaaaagcaatagaaagtggtattttaaatgatgaaatacac
cctatcatgacaaaagattcttcaatcatggatgatgatggaataagatttaaccaaact
attcaagccctaaacaaactaaaaccaatatttgatagaaatggaactgtaacagctgga
aactcatctcaagtttcagatggtgcttgtatgatgatattatgctctgaatcaaaagca
aaagagttgggtcttgagccaataggttttataaaagattatgcttatgctggtcttgat
gccaataaaatgggcttaggtccaatctttgccacaaaaaaactatttgataaaacaggt
gtcagtctaaaaaatatagatttaatagaactaaatgaagcctttgctgcgcaagttatt
gcaaaccttgaagcttttaaatcaaaaagtttttgcaaaaaagagtttaactctgagcct
cttggtgaaataaatgaagagatattaaatgtaaatggaggagcaattgccattggtcat
ccagttggtatgagtggagctagaattgtacttcacacagtaaaagaacttaaaagaaaa
ggcctaaaaactggtcttgctacactttgtgttggtggtgggcaaggtgcaagtttttta
gtggaggtataa

DBGET integrated database retrieval system