KEGG   Arcobacter nitrofigilis: Arnit_1406Help
Entry
Arnit_1406        CDS       T01235                                 

Definition
(GenBank) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
ant  Arcobacter nitrofigilis
Pathway
ant00330  Arginine and proline metabolism
ant01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ant00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Arnit_1406
Enzymes [BR:ant01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Arnit_1406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-ProteinID: ADG93064
UniProt: D5V5C9
Position
1377614..1378465
Genome map
AA seq 283 aa AA seqDB search
MEAQNSSFIGFENDYEESKAVLFGAPFDGTTSFKPGARFAPPAMRQDSWAIESYSPYFDS
DLEDLKLFDYGDLELPFGDKKNALRMIQEHVQEIIDANKIPIMIGGEHLVSLAPVKALSK
KYEDLHIIHFDAHTDLREDYLGEALSHATVIRRIYDQVGDGKVNQFCIRSGLKEEFEWAK
KHTHLEKFTYNTLPSCVKRLKDKPVYITIDLDVLDPSVMPGTGTPEPGGIDFHDMMNIIK
ELSKLNNVVGMDVVELSPKYDASGISTAVACKTLRELVLATVK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggaagcacaaaacagtagttttattggctttgaaaatgattacgaagaatcaaaagca
gttttatttggagcgccatttgatggaactacttcatttaaaccaggagctagattcgct
ccccctgcaatgagacaagactcttgggcaatagagagttatagcccatattttgatagt
gatttagaagatttaaaactatttgattatggggatttagaattaccatttggagataaa
aaaaatgccctaagaatgattcaagaacatgttcaagaaatcattgatgcaaataaaatt
ccaattatgataggtggagaacatttagtttccctggcccctgtaaaagctttaagtaag
aagtatgaggatttacacattatacattttgatgcacacacagatttaagagaagactat
ttaggcgaagctttaagccatgcaacagttattagaagaatttatgatcaagtaggcgat
ggaaaagtaaatcaattctgtattcgttctggattaaaagaggagtttgaatgggcaaaa
aaacatactcacttagaaaaattcacttataacactttaccttcttgtgtaaaaagatta
aaagacaaacctgtttatatcactattgatttagatgttttagatccttctgtcatgcca
ggaactggaacaccagaaccaggtggaatagattttcatgatatgatgaatatcataaaa
gaattaagtaaattaaataatgtagttgggatggatgttgtagaattaagtcccaaatat
gatgcaagtggaatctcaactgctgttgcatgtaaaacacttcgagaattagttttagct
acagttaaataa

DBGET integrated database retrieval system