KEGG   Arcobacter nitrofigilis: Arnit_1742
Entry
Arnit_1742        CDS       T01235                                 

Definition
(GenBank) type VI secretion protein, VC_A0107 family
  KO
K11901  type VI secretion system protein ImpB
Organism
ant  Arcobacter nitrofigilis
Brite
KEGG Orthology (KO) [BR:ant00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ant02044]
    Arnit_1742
Secretion system [BR:ant02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Arnit_1742
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ADG93396
UniProt: D5V1G2
Position
1736648..1737136
AA seq 162 aa
MNKQSESPKERINVTYKPATGDVQEDVEIPFKITLLGEYNPNEEKKPVEEIKAIKVDKNN
FNDVLKGQNLSVSFNVENKLVKEEDSSLGVNLKINTIKDFSPENVVENVPEMKVLMELRK
SLMALKGPLGNVPAFRKAIESAIYNKEERDKLMSELNLDSKE
NT seq 489 nt   +upstreamnt  +downstreamnt
atgaataaacaatcagaatcaccaaaagagagaattaatgtcacttataaaccagcaaca
ggggatgttcaagaagatgtagaaattccttttaaaataacattattaggtgaatataat
ccaaatgaagagaaaaaaccagttgaagaaataaaagcaataaaagttgataaaaataat
tttaacgacgtattaaaaggacaaaatttatctgtctcttttaatgttgaaaataaatta
gtgaaagaagaagatagttctttgggggtgaatttaaaaattaacacaattaaagatttt
tcaccagaaaatgtcgttgaaaatgttcctgaaatgaaagttttaatggaattaagaaaa
tcattaatggcattaaaaggcccactaggtaacgttcctgcatttagaaaagcaattgag
agtgctatttataataaagaggaaagagataaattaatgtctgaattaaatttagattca
aaagaataa

DBGET integrated database retrieval system